KEGG   Burkholderia sp. HB1: AC233_31520Help
Entry
AC233_31520       CDS       T04094                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00220  Arginine biosynthesis
buq01100  Metabolic pathways
buq01110  Biosynthesis of secondary metabolites
buq01130  Biosynthesis of antibiotics
buq01230  Biosynthesis of amino acids
Module
buq_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AC233_31520
Enzymes [BR:buq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     AC233_31520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ALE59014
UniProt: A0A0M4P871
Position
2:complement(2540218..2541216)
Genome map
AA seq 332 aa AA seqDB search
MAFNLRNRSLLNMQDFTPRDIRFLLDLSAELKRAKYAGNEVPRLNGKNVALIFEKTSTRT
RCAFEVAVHDQGGHVTYIDSSSSQLGRKESLKDTARVLGRLYDGIEYRGFHQSVVEDLAT
YSHVPVWNGLTDEFHPTQVLADLLTMQEFGEKPLHELSFCYLGDARFNMGNSLLIGGVQM
GMDVRIAAPRDLWPHDELVQQMRHLAERTGANVTITDDPYEAVSGVDFIYTDVWVSMGEP
VEAWGPRIDLLLPYQVNARLMKATGKARTRFMHCLPAYHNLETETGRTIHERFGLSELEV
SDEVFESNASIVFSQAENRMHTIKAVLVATLA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcattcaatctacgcaatcgcagcctgctgaacatgcaggacttcaccccacgcgac
atccgttttctgctcgacctctccgcggaactcaagcgcgcgaaatacgcgggcaacgag
gtgccacggctgaacggcaagaacgtggcattgattttcgaaaagacctcgacgcgcacg
cgttgcgcattcgaggttgcggttcacgaccagggcgggcacgtcacctacatcgattcg
tccagttcgcagctcggccgcaaggaatcgctcaaggacaccgcacgcgtgcttgggcgc
ctttacgacggcatcgaataccgcggctttcatcaaagcgtggtggaagatctcgcgacc
tattctcatgtaccggtgtggaacgggctcaccgacgaattccacccgacccaggtgctc
gccgatctgcttaccatgcaggagttcggagaaaagccgcttcacgagctgtcgttctgc
tacctcggcgatgcgcgcttcaacatgggcaattctctgctgatcggcggcgtgcagatg
ggcatggacgtgcgcatcgcagcgccacgcgacctatggccacacgacgaactggtgcag
cagatgcggcacctggccgagcggaccggcgccaacgtgacgatcacggacgacccgtat
gaggcggtgagcggcgtcgatttcatctataccgacgtttgggtgtcgatgggcgagccg
gtcgaagcgtggggtccgcgcatcgatctgctgctgccctaccaggtcaacgccaggctg
atgaaggcaacgggcaaggcgcgcacacgcttcatgcattgcctgccggcgtatcacaac
ctggagacggaaacaggacgcacgattcacgagcgctttggcctgtccgaactggaggtc
agcgacgaagtgttcgagtcgaacgcatcgattgtattttcgcaagccgaaaaccgcatg
cacaccatcaaggccgtgctcgtggcaaccctcgcataa

DBGET integrated database retrieval system