KEGG   Burkholderia sp. HB1: AC233_32755Help
Entry
AC233_32755       CDS       T04094                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00970  Aminoacyl-tRNA biosynthesis
buq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:buq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AC233_32755
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:buq03029]
    AC233_32755
Enzymes [BR:buq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AC233_32755
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AC233_32755
Mitochondrial biogenesis [BR:buq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AC233_32755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Nucleolin_bd DUF745
Motif
Other DBs
NCBI-ProteinID: ALE59247
UniProt: A0A0M4PLA1
Position
2:complement(2802090..2803499)
Genome map
AA seq 469 aa AA seqDB search
MTSELLYLDATRLAELIRTHEVSPVEVVKAHLDRIDAVDPKVNAIVTVADDALEAARAAE
TAVLSGKALGPLHGVPFTAKDSIDTAGVATQRGSPIFKGRVPDADATSVARLKNAGGILL
AKTNLPEFSYWIESDNLLSGRSNNPWDLERTPGGSSGGESAAIAAGMSPLGLGTDLAISV
RGPAAQTGIVSLKATHGRVPMTGIWPRAPRRFWHVGPMARSIRDLALAFSQLSGPDGHDA
FASSTVPFDAGVGRSPDRPLRVGWMVEPGFGPVDPQVAATVQAAAEALKSLGLVVEPVRI
PALERDFALDVFNRLHVMEMKPAFAEVTAGRAEDELYKMAKTMLALPDTSMRDYIDAEQA
AERLRDGYAEYFRNYDALITHVLPIPAHKHGVDTFSINGHAVDATYLQGATVPLNVTGLP
GISMRFGTSKEGLPINVQIVGSWQAESTILHVASLLESVSPVRDLHPHI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgaactcctttacctcgatgccacccgactggccgaactgatccgcacacac
gaagtctcgcccgtcgaggtcgtgaaggcacaccttgatcgcatcgacgcggtcgatccg
aaagtcaatgcgatcgtgacagtcgcggacgatgcgctggaagccgccagggctgccgaa
acggcagtgctgtcgggcaaggcgttggggccgctgcacggagtgcccttcaccgcaaaa
gattcgatcgacacggcgggcgtggcgacgcaacgtggctcgcccatctttaaaggacgc
gttcctgacgccgacgcaactagcgtggcccggctgaaaaacgcaggcggcatccttctc
gcaaaaacgaacttgcccgaattctcgtactggatcgaaagcgacaatctgctcagtggc
cgatcgaataatccgtgggatctggagcgcactccgggcggctccagcggcggcgaatcg
gcggccatcgcagcgggtatgtcgccgctggggctcggcaccgatctggcgatctctgtg
cgcggacccgctgcgcagacaggcatcgtgtcgctaaaggcgactcacggacgcgtgccc
atgacagggatctggccgcgcgccccacgccgcttctggcacgtgggtccgatggctcgc
agcatccgcgacctggcgctcgcgttctcgcagttgtccggtcccgatgggcacgacgct
tttgcaagcagtaccgtcccgttcgatgccggcgtgggccgctcaccagaccgtccgctg
cgagtgggctggatggttgaaccgggcttcgggcccgtcgatccgcaagtcgcggcaacg
gtgcaggcggcggcggaagcgctcaaaagtttggggctagtggtggagcctgtacgcatt
cctgccctcgagcgtgacttcgctctcgacgtcttcaaccgcctgcacgtcatggaaatg
aagccggcctttgcggaagtgacagcaggtcgcgctgaggacgaactctacaagatggcc
aagacgatgctggcgctgcccgacacttcgatgagggactacatcgacgctgaacaggcg
gccgagcgtctgcgagacggatacgccgaatacttccggaattacgacgcgctgattacg
catgtgcttccgatcccggctcacaagcacggcgtggacacgttctcgatcaacggccac
gcagtggatgccacctatctgcagggcgcaactgtgccgttgaacgtcacgggcttgccc
ggcatctcgatgcgcttcggcacgagcaaggaggggctgccgatcaacgtacagattgtc
gggagttggcaggctgagtcaaccattcttcacgttgcgtcactactcgaatcggtcagc
ccggtgcgcgatctacatccgcatatttga

DBGET integrated database retrieval system