KEGG   Burkholderia sp. HB1: AC233_33595Help
Entry
AC233_33595       CDS       T04094                                 

Definition
(GenBank) aldehyde dismutase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00625  Chloroalkane and chloroalkene degradation
buq00680  Methane metabolism
buq01100  Metabolic pathways
buq01120  Microbial metabolism in diverse environments
buq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    AC233_33595
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AC233_33595
Enzymes [BR:buq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     AC233_33595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ALE59407
UniProt: A0A0M4P5V7
Position
2:2999475..3000674
Genome map
AA seq 399 aa AA seqDB search
MSSNRGVVYLGQGKVEVQSIDYPKMVDPRGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
EVGLVLGHEITGEVIEVGRDVETLSVGDLVSVPFNVACGRCPTCKSQHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVMVPYADFNLLKFPDRAQAMSKIRDLTCLSDILPTGYHGAV
MAGVKPGATVYIAGAGPVGMAAAASARLLGAACTIVGDMNEERLAHARKMGFETVDLSKD
ATLGEQIEQILGKPEVDCAVDCVGFEAHGHGSSGSHEEAPATVLNSLMEITRAAGAIGIP
GLYVTDDPGAADAAARKGSLSIRFGLGWAKSHSFHTGQTPVMKYNHNLMQAILWDRLPIA
DIVNVTVVSLDQAPDGYRQFDGGAPRKFVIDPHGLLKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgcggcgttgtctatctggggcagggcaaggttgaagtgcaatcgatc
gactatccgaagatggtcgacccacgcggccgtgcgatcggtcacggtgtgattctgaag
gtggtcagcacgaatatttgcggctccgaccagcacatggtgcggggccgcacgaccgcg
gaagtcggcctcgtgctcggccacgagattaccggcgaagtgattgaggtcggccgcgac
gtcgagacgctgagcgttggcgatctcgtctccgtgccgttcaacgtggcatgcggacgg
tgtccgacctgcaagtcgcagcataccggcgtgtgcctgaacgtgaacccgtcgcgtgcg
ggcggcgcttacggatacgtggatatgggcggctggatcggcggccaggccgagtacgtg
atggtgccgtatgccgacttcaatctgctgaagtttcccgaccgcgcgcaggcgatgtcg
aagattcgcgacctgacgtgcctgtccgacattctgccgaccggttatcacggcgcggtc
atggcaggcgtgaagccgggcgcgacggtttatatcgcaggcgccgggccggtgggcatg
gcggcggctgcgtcggcgcgtctgttgggcgcggcgtgcacgatcgtcggcgacatgaac
gaggagcgccttgcgcatgctcgcaagatgggattcgagaccgtggatctgtcgaaggat
gcgacgctcggcgaacagatcgagcagattctgggtaagccggaagtggattgcgcggtg
gactgcgtgggcttcgaggcgcacggccacggcagcagcggctcgcacgaggaagcaccc
gccactgtgctgaactcgctgatggaaatcacgagggctgcgggggcgatcggtattccg
gggctctatgtcaccgacgatccgggcgccgcggacgcagccgcgcgcaaggggagtctg
agcatccgcttcgggctcggctgggcgaagtcgcattcgttccacacgggccagacgccg
gtgatgaagtacaaccacaatctgatgcaggcgattctttgggaccgtctgccgattgcg
gacatcgtgaacgtgacggtggtgtcgctcgatcaggcgccggacggttatcgccagttc
gacggcggcgcgccgcgcaagttcgtgatcgatccgcatgggctgttgaaggcggcttga

DBGET integrated database retrieval system