KEGG   Burkholderia lata: Bcep18194_A3559
Entry
Bcep18194_A3559   CDS       T00286                                 

Definition
(GenBank) uncharacterized conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bur02044]
    Bcep18194_A3559
Secretion system [BR:bur02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep18194_A3559
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABB07160
UniProt: Q39K56
Position
1:424831..425346
AA seq 171 aa
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGDLAGQSEIEQPKLRDR
KFVNIDRDNFDDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRSLSDFSPDEVVEQVEPL
RRLLEARSKLADLRNKLAGNDKLEDLLSEVLKNTQQLQELAKGTGGDKDGE
NT seq 516 nt   +upstreamnt  +downstreamnt
atggccaagaaagaaagcattcagaaaagcttgcagaaaatacggccgccgcgcgtccaa
ctgacctacgaggtcgagaagggcgatgcgatcgaggtgaaggaactgccgttcgtcgtc
ggggtcgtcggcgatctggcgggccagtccgaaatcgagcagccgaagctgcgcgaccgt
aaattcgtcaacatcgatcgcgacaatttcgacgatgtgatgaaggcgatcgagccgcgt
gccgcgttccaggtggaaaaccgcctgagcccggaaggcggcaagttcgcggtcgacctg
aagttccgttcgctgtcggatttcagcccggacgaagtcgtcgaacaggtcgagccgctg
cgccgcctgctcgaggcgcgctcgaagctcgccgacctgcgcaacaagcttgccggcaac
gacaagctcgaggatctgctgtccgaagtgctgaagaacacgcagcagctgcaggagctc
gcgaagggcacgggcggcgacaaagacggcgaatga

DBGET integrated database retrieval system