KEGG   Burkholderia lata: Bcep18194_A3560
Entry
Bcep18194_A3560   CDS       T00286                                 

Definition
(GenBank) protein of unknown function DUF877
  KO
K11900  type VI secretion system protein ImpC
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bur02044]
    Bcep18194_A3560
Secretion system [BR:bur02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep18194_A3560
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ABB07161
UniProt: Q39K55
Position
1:425362..426852
AA seq 496 aa
MNQQTAAAQASGADYAAGTSLLDDIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVIVS
DNLSATIDARVAELDRLISTQLSAVMHAPEFQRLESTWRGMDYLVKESNTGQTIKIKALH
APKRDLVRDFKGASEFDQSALFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQM
SHVAAAAHAPFIASASPELLGLESFSDLGKPRDLGKVFDTVEYAKWKSFRDAEDSRYVGL
TLPRFLGRLPFNPKDGQTAENFNFVEDVDGTDHDKYLWCNAAWAFAARLTAAFDDFGWCA
AIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFIPLVHCKNSDY
AAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDEL
SISLRLVADLPKPANS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgaaccagcaaacggctgcggcccaagcgagcggcgcggattacgccgccgggacttcg
ctgctcgacgacatcgtcgagaagagcaaggtcgcgaaatccgattccgagcatgcgcgt
gcgaaggacctgatcggcgaactcgtgcaccaggtgctcgacggcacggtgatcgtgtcg
gacaacctgtcggccacgatcgacgcgcgcgtcgcggaactggaccgcctgatttccacg
cagctttccgcagtgatgcacgcgccggagttccagcgcctcgaaagcacgtggcgcggg
atggactacctggtcaaggaaagcaacaccggccagacgatcaagatcaaggcgctgcac
gcaccgaagcgcgacctcgtgcgcgacttcaagggcgcgagcgagttcgaccagagcgcg
ctgttcaagaaggtctacgaagaagaattcggcacgttcggcggttcgccgttcggtgcg
ctgatcggcgattacgagatctcgcgccagccggaagacatgtacttcatcgagcagatg
tcgcacgtcgcggcggccgcgcatgcgccgttcatcgcgtcggcatcgccggagctgctc
ggcctcgagtcgttctccgacctcggcaagccgcgcgacctcggcaaggtgttcgatacg
gtcgaatatgcgaagtggaagtcgttccgcgacgccgaagattcgcgctacgtcggcctg
acgctgccgcgcttcctcggccgcctgccgttcaatccgaaggacggccagacggcggag
aacttcaacttcgtcgaggacgtcgacggcaccgaccacgacaagtacctgtggtgcaac
gccgcgtgggcgtttgctgcgcgcctgacggccgcattcgacgacttcggctggtgcgcg
gcgatccgcggcgtcgaaggcggcggcctcgtcgaggacctgccgacccacacgttcaag
accgacgacggtgaagtcgcgctgaagtgcccgaccgaaatcgcgatcaccgatcgccgc
gagaaggagctgagcgacctcggcttcatcccgctcgtccattgcaagaactcagattac
gccgcgttcttcgctgcgcagtcggtgcagaaacccaagaaatacagcaccgacagcgcg
aatgcgaacgccgtcctgtccgcccagcttcagtacatcttctcggtatcgcgcgtcgcg
cactacctgaaggcgatgatgcgggacaagatcggcagcttcgcatcggcgcagaacgtg
gagactttccttaaccggtggatttcgcagtacgtcctgctcgacgataacgcctcgcag
gaacagaaagcgcaatttccgctgcgcgaggcatccatacaagtgtcagagattccgggc
aagccgggctcgtatcgttcggtcgcgttcctgcgcccgcactttcagctcgacgaactc
tcgatatctctgcgacttgtcgctgatctgcccaaaccggcaaattcataa

DBGET integrated database retrieval system