KEGG   Burkholderia lata: Bcep18194_A3561
Entry
Bcep18194_A3561   CDS       T00286                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bur  Burkholderia lata
Pathway
bur03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bur00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcep18194_A3561
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bur02044]
    Bcep18194_A3561
Secretion system [BR:bur02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep18194_A3561
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABB07162
UniProt: Q39K54
Position
1:426923..427426
AA seq 167 aa
MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMI
FTKEIDSSSPLLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVRE
EGLPLETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTKNDKTYAV
NT seq 504 nt   +upstreamnt  +downstreamnt
atgttacatatgcacttgcagtttggtagtcccgcggtgaagggcgaatccgcggacaag
gaccaccagggctggatcgagctgaaatcgtgggatcactcgatcgttcaaccgcgttcg
gcaaccgcatcgaccgcaggcggtcacacgatgacgcgttgcgaacacggcgacatgatt
ttcacgaaggaaatcgattcgtcgagcccgctgctgtaccaacacgcttcgggcggcacc
acgttcgacgaggtgacggtccatttctcgcgcgctgacggtgaaggcaagcgcgtgcag
tatctggaagtcaagctcaagtacgtgatcatctcgagcatcgccccgagcgttcgcgaa
gaaggtctgccgctcgagacgttctcgctgaagtacgcagctgtgcagtggaagcaaacc
cagcagaagatcggcggcaaccagggcggcaacacgcaaggcgcctggagtctgacgaag
aacgacaagacctacgcggtctaa

DBGET integrated database retrieval system