KEGG   Burkholderia lata: Bcep18194_A4287Help
Entry
Bcep18194_A4287   CDS       T00286                                 

Definition
(GenBank) amino acid ABC transporter membrane protein 1, PAAT family
  KO
K10016  histidine transport system permease protein
Organism
bur  Burkholderia lata
Pathway
bur02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bur00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bcep18194_A4287
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bur02000]
    Bcep18194_A4287
Transporters [BR:bur02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    Bcep18194_A4287
   Histidine transporter
    Bcep18194_A4287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABB07884
UniProt: Q39I32
Position
1:1225183..1225872
Genome map
AA seq 229 aa AA seqDB search
MFLYGFGPVLWAGTVQTIELSVLSLATAVALGLIGAVAKLSHNRVLRAIATGYTTLIRSV
PDLVLMLLLFYSIQIWLNQFTDFVGWDQIDIDPFVAGVLTLGFIYGAYFTETFRGAFLSV
PRGQLEAGAAYGMSGARVFARIMFPQMMRFALPGIGNNWQVLVKATALVSIIGLADVVKA
AQDAGKSTFNMFFFILVAALIYLAITTVSNLVLIQLEKRYSMGVRHADL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgttcctttacggctttggtcctgtcctctgggccggcaccgtgcagaccatcgagctg
tcggtgctgtcgctcgccactgcggtggcgctggggctgatcggcgcggtggcgaagctg
tcgcacaaccgggtgctgcgagcgatcgcgaccggttatacgacgctgatccgctcggtg
cccgatctcgtcctgatgctgctgttgttctacagcatccagatctggctgaaccagttc
accgacttcgtcggctgggaccagatcgacatcgacccgttcgtggccggcgtgctgacg
ctcggcttcatctacggcgcgtacttcaccgagacgttccgcggcgcgttcctgtcggtg
ccgcgcggccagctcgaagccggtgcggcttacgggatgagcggcgcacgcgtgttcgcg
cggatcatgtttccgcagatgatgcgcttcgcgctgcccgggatcgggaacaactggcag
gtgctcgtgaaggcgaccgcgctggtgtcgatcatcggcctcgcggacgtcgtgaaggcc
gcgcaggacgccggcaagagcacgttcaacatgttcttcttcatcctcgtcgcggcgctg
atctatctcgcgatcacgaccgtttccaacctcgtgctgatccagctcgagaagcgttat
tccatgggcgtgcggcacgcagatctatga

DBGET integrated database retrieval system