KEGG   Burkholderia lata: Bcep18194_A4674Help
Entry
Bcep18194_A4674   CDS       T00286                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bur  Burkholderia lata
Pathway
bur00061  Fatty acid biosynthesis
bur00071  Fatty acid degradation
bur01100  Metabolic pathways
bur01212  Fatty acid metabolism
bur02024  Quorum sensing
Module
bur_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Bcep18194_A4674
   00071 Fatty acid degradation
    Bcep18194_A4674
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bcep18194_A4674
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bur01004]
    Bcep18194_A4674
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bur04147]
    Bcep18194_A4674
Enzymes [BR:bur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Bcep18194_A4674
Lipid biosynthesis proteins [BR:bur01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Bcep18194_A4674
Exosome [BR:bur04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Bcep18194_A4674
  Exosomal proteins of breast cancer cells
   Bcep18194_A4674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ABB08269
UniProt: Q39GZ7
Position
1:complement(1665005..1666759)
Genome map
AA seq 584 aa AA seqDB search
MSSSAATAAAQVPPNTDGIWYASYPPGVPHEIDVTQYASLVQFFDECTSRFAERVAYVSA
GASMTYRTLAQKVDAFASYLQSIGIKPGDRVAIMLPNTFQYPVALFGTLKAGAIVVNVNP
LYTVRELAHQLKDSGAQTIVVFENFARTLQDALPETQVKNIVVTALGDLLADGFNAKGRL
INFVLKHVKKLVPAYHLPQAIRLRSALALGARGKPQPVQITRDDLAFLQYTGGTTGVAKG
AMLTHGNLIANLLQAKAWIADQVSGDVETVLTPLPLYHIYSLTVNAFIFMGLGGRNILIA
NPRDMTMVMKIIRNETFTGITGINTLYNAFLDNEEFRKRDFSKLKLAMAGGMAMQRAVAE
RFQQVTGRPVVEGYGLTECSPIVTMNPVDLNDMAAFSGSIGLPAPSTVVRFRREDGTWAP
IGEPGELCVHGPQVMRGYWQRPDETTKVIDADGWLGTGDIGVMDERGFIRLIDRKKDMIL
VSGFNVYPNEIEEVLVMHPGISEAAAIGIPDEVQGERIKVFVVRRDPSLTVDDVLAHCRK
NLTGYKMPKFVEFRDALPQTNVGKILRRALRDEELAKIKAAKQG
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcttccgcagcaaccgcagcggcccaggttccgccgaacaccgacggcatctgg
tacgcgtcatacccgcccggcgtcccgcacgagatcgacgtcacgcaatacgcatcgctc
gtgcagttcttcgacgaatgcacgagccgcttcgccgaacgcgtcgcctacgtgagcgca
ggcgcatcgatgacctatcgcacgctcgcgcagaaagtcgacgcgttcgcgtcgtacctg
caaagcatcggcatcaagcccggcgaccgcgtcgcgatcatgctgccgaacacgttccag
tacccggtcgcgctgttcggcacgctgaaggccggcgcgatcgtcgtcaacgtcaatccg
ctctacaccgtgcgcgaactcgcgcaccagctgaaggacagcggcgcgcagacgatcgtc
gtgttcgagaacttcgcgcgcacgctgcaggacgcgctgccggaaacgcaggtgaagaac
atcgtcgtcaccgcgctcggcgacctgctcgccgacggcttcaatgcgaaaggacgcctg
atcaatttcgtgctgaagcacgtgaagaagctcgtgccggcctaccatctgccgcaggcc
atccggttgcgctccgcccttgcgctcggtgcgcgcggcaagccgcagcccgtgcagatc
acgcgcgacgacctcgcgttcctgcaatacacgggcggcacgaccggcgtcgcgaaaggc
gcgatgctcacgcacggcaacctgatcgcgaacctgctgcaggcgaaggcgtggatcgcc
gaccaggtctcgggcgatgtcgaaaccgtgctcacgccgctgccgctgtatcacatctat
tcgctgacggtgaacgcgttcatcttcatggggctcggcgggcgcaacatcctgatcgcg
aacccgcgcgacatgacgatggtgatgaagatcatccgcaacgagacgttcaccgggatc
accggcatcaacacgctgtacaacgcgttcctcgacaacgaggaattccgcaagcgcgat
ttctcgaagctcaagctcgcgatggccggcgggatggcgatgcagcgcgcggtcgcggag
cgcttccagcaggtgacaggccggccggtcgtcgaaggctacggcctgaccgaatgctcg
ccgatcgtcacgatgaatcccgtggacctgaacgacatggccgcattcagcggttcgatc
ggcctgcccgcgccgtccaccgtcgtgcgctttcgccgcgaggacggcacctgggcgccc
atcggcgaaccgggcgagctgtgcgtgcatggtccgcaggtgatgcgcggctactggcag
cgccccgacgagacgaccaaggtgatcgacgccgacggctggctcggcaccggcgacatc
ggcgtgatggacgaacgcggcttcatccgcctgatcgaccgcaagaaggacatgatcctc
gtgtcgggcttcaacgtgtatccgaacgaaatcgaggaagtgctggtgatgcatccgggc
atcagcgaagccgcggcgatcggcattcctgacgaggtacagggcgaacggatcaaggtg
ttcgtcgtgcgccgcgacccgtcgctgacggtcgacgacgtcctcgcgcactgccgcaag
aacctgaccggctacaagatgccgaaattcgtcgagttccgcgacgcgctgccgcagacg
aacgtcggcaagatcctgcgccgcgcgctgcgcgacgaggagctcgccaaaatcaaggcc
gcgaagcaaggctga

DBGET integrated database retrieval system