KEGG   Burkholderia lata: Bcep18194_A5341Help
Entry
Bcep18194_A5341   CDS       T00286                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bur  Burkholderia lata
Pathway
bur00300  Lysine biosynthesis
bur01100  Metabolic pathways
bur01120  Microbial metabolism in diverse environments
bur01230  Biosynthesis of amino acids
Module
bur_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bcep18194_A5341
Enzymes [BR:bur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Bcep18194_A5341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABB08935
UniProt: Q39F31
Position
1:2399374..2400513
Genome map
AA seq 379 aa AA seqDB search
MSATLALTEQLIARASVTPDDQHCQQIMTERLTALGFECETIASHGVTNLWAVKRGTDGR
DGKLLAFAGHTDVVPTGPLEQWSSPPFIPAHRDGKLYGRGAADMKTSLAAFVVASEEFVA
AHPGHRGTIAFLITSDEEGPATDGTVKVVELLEARGERMDYCIVGEPTSTTELGDVVKNG
RRGSMSGELVVKGVQGHIAYPHLAKNPIHLLAPALAELAAEQWDEGNEYFPPTTWQVSNL
HAGTGASNVIPGHADLLFNFRFSTASTVEGLQARVHAILDKHGLEYTLKWSVSGLPFLTP
RGELSGALENAIRTETGITTELSTTGGTSDGRFIARICPQVIEFGPPNGSIHKIDEHIEV
RFVDPLKNVYRRVLEQLIA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaccctagcccttaccgaacagctgatcgcccgcgcgtccgtgacgcccgac
gaccagcattgccagcagatcatgaccgagcgcctcaccgcgctcggcttcgaatgcgag
accatcgcgtcgcacggcgtgaccaacctgtgggccgtcaagcgcggcaccgacggccgc
gacggcaagctgctcgcgttcgcgggccacaccgacgtcgtgccgaccggcccgctcgag
cagtggagctcgccgccgttcatccccgcccatcgtgacggcaagctgtacggccgcggc
gcggccgacatgaagacatcgctcgcggcattcgtcgtcgcgtccgaggaattcgtcgcg
gcccatcccggccaccgcggcacgatcgcgttcctgatcacgagcgacgaggaaggcccc
gccaccgacggcaccgtgaaggtcgtcgagctgctcgaagcgcgcggcgaacgcatggac
tactgcatcgtcggcgagccgacgtcgaccaccgagcttggtgatgtcgtgaagaacggc
cgccgcggctcgatgtcgggcgaactggtcgtcaagggcgtgcagggccacatcgcgtat
ccgcacctcgcgaagaacccgatccacctgctcgcgccggcgctcgccgagctcgccgcc
gagcagtgggacgaaggcaacgaatacttcccgccgaccacctggcaggtgtcgaacctg
cacgccggtaccggtgcgtccaacgtgattcccggccacgccgacctgctgttcaacttc
cgcttctcgaccgccagcacggtcgagggcctgcaggcacgcgtgcacgcgattctcgac
aagcatggcctcgaatacacgctgaagtggtcggtgagcggcctgccgttcctcacgccg
cgcggcgagctgtcgggcgcgctggaaaacgcgatccgcaccgaaaccggcatcacgacc
gaactgtcgacgacgggcggcacgtcggacggccgcttcatcgcgcgcatctgcccgcag
gtgatcgagttcggcccgccgaacggcagcatccacaagatcgacgagcacatcgaagtg
cgcttcgtcgacccgctgaagaacgtgtaccgccgcgtgctcgaacaactgatcgcctga

DBGET integrated database retrieval system