KEGG   Burkholderia lata: Bcep18194_A5579Help
Entry
Bcep18194_A5579   CDS       T00286                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bur  Burkholderia lata
Pathway
bur00010  Glycolysis / Gluconeogenesis
bur00051  Fructose and mannose metabolism
bur00562  Inositol phosphate metabolism
bur00710  Carbon fixation in photosynthetic organisms
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur01120  Microbial metabolism in diverse environments
bur01130  Biosynthesis of antibiotics
bur01200  Carbon metabolism
bur01230  Biosynthesis of amino acids
Module
bur_M00002  Glycolysis, core module involving three-carbon compounds
bur_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep18194_A5579
   00051 Fructose and mannose metabolism
    Bcep18194_A5579
   00562 Inositol phosphate metabolism
    Bcep18194_A5579
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bcep18194_A5579
Enzymes [BR:bur01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bcep18194_A5579
Exosome [BR:bur04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bcep18194_A5579
  Exosomal proteins of bladder cancer cells
   Bcep18194_A5579
  Exosomal proteins of melanoma cells
   Bcep18194_A5579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABB09173
UniProt: Q39EE3
Position
1:complement(2675845..2676600)
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGAGAVAAETSIGVCVPFPYLAQVQAQLDG
GRVAWGAQDVSAHEQGAFTGEVAAAMVAEFGARYAIVGHSERRAYHGERNETVAAKTQRA
LAAGLTPVVCVGETLDERESGATEQVVGAQLDAVLAVLTADEATRIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRARLAAKGAADVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
EDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacagagaactaagcgtgtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgttgctgaacgaagtggtgcagggcgcgggcgcggtggcggccgaaacg
tcgatcggcgtgtgcgtgccgttcccgtatctcgcgcaggttcaggcgcagctcgacggc
ggccgtgtcgcctggggtgcgcaggacgtgtcggcgcacgaacagggcgcgttcaccggt
gaagtcgcggccgcgatggtcgcggagttcggcgcacgctatgcgatcgtcggtcactcg
gagcgccgcgcgtatcacggcgaacgcaacgagacggtcgccgcgaagacgcagcgcgcg
ctcgcagcggggctcacgccagtcgtgtgcgttggcgagacgctcgacgagcgcgagtcg
ggtgcgaccgagcaggtggtcggtgcgcagctcgacgcagtgctggccgtgctgacggct
gacgaagcgacgcgcatcgtcgtcgcatacgagccggtctgggcgatcggcacgggcaag
agcgcgacgtcggcgcaggcacaggacgtgcacgcgttcctgcgtgcgcgtctcgcggca
aagggtgcggcggacgtgtccgtgctgtacggcggcagcgttaagccggacaacgcggaa
gagctgtttgcgcagccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggcg
gaagatttcctggcgatctgccgggccgcgcgttga

DBGET integrated database retrieval system