KEGG   Burkholderia lata: Bcep18194_A5976Help
Entry
Bcep18194_A5976   CDS       T00286                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bur  Burkholderia lata
Pathway
bur00020  Citrate cycle (TCA cycle)
bur00640  Propanoate metabolism
bur00660  C5-Branched dibasic acid metabolism
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur01120  Microbial metabolism in diverse environments
bur01130  Biosynthesis of antibiotics
bur01200  Carbon metabolism
Module
bur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bur_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcep18194_A5976
   00640 Propanoate metabolism
    Bcep18194_A5976
   00660 C5-Branched dibasic acid metabolism
    Bcep18194_A5976
Enzymes [BR:bur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bcep18194_A5976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp K-cyclin_vir_C
Motif
Other DBs
NCBI-ProteinID: ABB09570
UniProt: Q39D96
Position
1:complement(3106046..3107212)
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMVEEGADIKQELYVSLVVDRVTQK
IVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQADDLAAKIGVPAASIPQARAI
LQGLYKAFWETDASLAEINPLNVSSDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPDLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LADSGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggttgacgaggccgtcaaggtggcagaagagctcggcggc
ccggtatgggtcgtgaaggctcagattcacgcaggtggccgtggcaagggcggcggcgtg
aaggtggcgaagtcgatcgagcaggttcgcgaatacgcgaaccagatcctcggcatgcag
ctcgtcacgcaccagaccggtccggaaggccagaaggtcaaccgtctgatggtcgaagaa
ggcgccgacatcaagcaggaactgtatgtcagcctcgtcgtcgatcgcgtgacgcaaaag
atcgttctgatgggttcgagcgaaggcggcatggacatcgaagaagttgccgaaaagcac
ccggaactgatccacaaggtcatcgtcgagccgtcgacgggcctgctggacgcgcaagcc
gacgacctcgccgcgaagatcggcgtgccggccgcttcgattccgcaagcacgcgcaatc
ctgcaaggcctgtacaaggcattctgggaaaccgacgcatcgctggctgaaatcaacccg
ctgaacgtctccagcgacggcaaggtcatcgcactcgacgcgaagttcaacttcgactcg
aacgcgctgttccgccatccggaaatcgtcgcgtaccgcgatctggacgaagaagatccg
gctgaaatcgaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgtctcgtgaacggcgcaggcctggcgatggcgacgatggacaccatcaagctgttcggc
ggcgagccggcgaacttcctggacgtcggcggtggcgcgacgaccgagaaggtcacggaa
gcgttcaagctgatgctgaagaacccggatctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgccggttcgaaggccgtgaac
ctgaacgtgccgctcgtcgtgcgcatgaagggcacgaacgaggacctcggcaaaaagatg
ctggccgattcgggcctgccgatcatctcggcggacagcatggaagaagctgcccagaag
gtcgtcgcggctgccgcaggcaagtaa

DBGET integrated database retrieval system