KEGG   Burkholderia lata: Bcep18194_A6075Help
Entry
Bcep18194_A6075   CDS       T00286                                 

Definition
(GenBank) Lipolytic enzyme
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
bur  Burkholderia lata
Pathway
bur00903  Limonene and pinene degradation
bur00930  Caprolactam degradation
bur01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bcep18194_A6075
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Bcep18194_A6075
Enzymes [BR:bur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     Bcep18194_A6075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: ABB09669
UniProt: Q39CZ7
Position
1:complement(3217601..3218563)
Genome map
AA seq 320 aa AA seqDB search
MSWQSKFACWLLRWQFRPETTREVLDPARARRFTDLRMVVPRRAPSGYRLRQCYGPGDAP
LRGEWLERTDAGAGRGPGRTLLYFHGGGYYFCSTKTHRPLVFGLTKRAGVRSFSLDYRLA
PENRFPAALDDALAAYRQLLALGTPPESIVLGGDSAGGGLALATLVALRDRGEPLPAGAI
LFSPWTDLAATGATLRTNDGADPMFAGAALPKAAKLYLGDEPGTNPYASPLYADFAGLPP
LYIQVGSTEVLLDDSRRVAEKAKAAGVAVEIEVWPDMPHVWQLYAPMVPEARDALDRAAA
FLRRVAVERAVQRAGEASIA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcaaagcaagttcgcctgctggctgctgcgctggcagttccggcccgagacc
acgcgcgaggtgctggatcctgcccgcgcacggcgctttaccgacctgcggatggtcgtg
ccgcgccgtgcgccgtcgggctaccggctgcgccagtgctatggcccgggcgacgcgccg
ctgcgcggcgagtggctcgaacgcaccgacgcgggcgcgggccgcgggcccggccgcacg
ctgctgtacttccacggcggcggctattacttctgttcgacgaagacccaccgtccgctc
gtgttcggcctgacgaagcgcgcgggcgtgcgctcgttctcgctcgactaccggctggcg
cccgaaaaccgcttcccggccgcgctcgacgatgcgctggccgcgtaccggcaactgctg
gcgctcggcacgccgcccgagtcgatcgtgctcggcggcgattcggcgggcggcggcctt
gcgcttgcgacgctcgttgcgctgcgcgaccgcggcgagccgctgccggccggcgcgatc
ctgttctcgccgtggaccgacctggccgccaccggcgccacgctgcgcacgaacgacggc
gccgatccgatgttcgcgggtgcggcgctgccgaaggccgcgaagctgtacctgggcgac
gagcccggcacgaatccgtacgcatcgccgctctatgcggatttcgcgggcctgccgccg
ctgtatatccaggtcggcagcaccgaggtgctgctcgacgattcgcgccgcgtcgccgag
aaggcaaaggcggccggggtagcggtggagatcgaggtgtggccggacatgccgcacgtg
tggcagctgtacgcgccgatggtgcccgaagcgcgcgacgcgctcgaccgcgcggccgcg
ttcctgcgccgcgtcgcggtcgaacgtgcggttcagcgggccggcgaggcgtcgatcgcc
tga

DBGET integrated database retrieval system