KEGG   Burkholderia lata: Bcep18194_A6306Help
Entry
Bcep18194_A6306   CDS       T00286                                 

Definition
(GenBank) Phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bur  Burkholderia lata
Pathway
bur00562  Inositol phosphate metabolism
bur00564  Glycerophospholipid metabolism
bur00565  Ether lipid metabolism
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Bcep18194_A6306
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bcep18194_A6306
   00565 Ether lipid metabolism
    Bcep18194_A6306
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bcep18194_A6306
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bur02042]
    Bcep18194_A6306
Enzymes [BR:bur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     Bcep18194_A6306
Bacterial toxins [BR:bur02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   Bcep18194_A6306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: ABB09900
UniProt: Q39CB6
Position
1:3470935..3473055
Genome map
AA seq 706 aa AA seqDB search
MTSSSRRRFLHTVAQSAGAAVALNAFPESIRRALAIPAARGTGTIRDVEHIVVFMQENRS
FDHYFGHLRGVRGYNDRFPIPLPNGKPVWYQPSKADPGKPVLPFRLNTLTTSAQCVGDLD
HSWYKTHAAIDGGRYDQWPANKTDMTMGYHVREDIPFHYALADAFTVCDNYFCSLPGPTH
PNRSYLMTGTVDPTGKFGGPLLDNSDYVDGDGPPAYQLLSWTTFPERLEAHGVSWQIYQQ
GTTGNDPYNGNYGTNVLQNFANFINAKPGSSLYQRAQTVRTLDNLKDDVINDRLPQVSWL
CPPAAFSEHPKYTPAYGANYTSQILDALTSNPDVWRKTVLFIMYDENDGFFDHVVPPQPP
TSAAQGASTVTTDGELHTVVNPGRGGSYTADGLPYGLGPRVPMTVVSPWTKGGFVCSQVF
DHTSVIRFIGERFGIDEPNITPWRRTVCGDLTAAFDFRSSDASFPPLPDTSQYRSIADQQ
CTSQPAPTVPATPSPIDPQEPGVRPARALPYELHVNASIDGGTRLRIEFANRGNQGAHFH
VYSTNRTDGPWRYTVGARRVLHADFDLTVTNGAYTFSVYGPNGFVRVFSGNVSAPAAPHR
NPAQPEVKAGYDVANGNLYLKLRNPGGAHVTLTLTDNAYGAPSRQVTLHGGDERVEQWAL
AASHQWYDVTVSDGAAGTFSRRFAGHVENGRPSYSDPAAVQPVSAA
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcatcgagccgccgccgtttcctgcataccgtcgcacaatccgcgggcgccgcc
gtcgcgctcaatgccttccccgaatcgatccgccgcgcgctcgcgattcccgccgcgcgc
ggcaccggcacgatccgcgatgtcgagcacatcgtcgtgttcatgcaggaaaaccgctcg
ttcgatcattacttcggacacctgcgcggcgtgcgcggctacaacgaccgcttcccgatc
ccgctgccgaacggcaagccggtgtggtaccagccgtcgaaggccgacccgggcaagccg
gtgctgccgttccggctgaacacgctgacgacgagcgcgcagtgcgtcggcgacctcgac
cactcgtggtacaagacgcacgcggcgatcgacggtggccgctacgaccagtggcccgcg
aacaagaccgacatgacgatgggctatcacgtgcgcgaggacatcccgttccactacgcg
ctcgccgatgcgttcaccgtgtgcgacaactacttctgctcgctgccggggccgacgcac
ccgaaccgctcgtacctgatgacgggcaccgtcgacccgaccggcaagttcggcggcccg
ctgctcgacaacagcgactatgtcgacggcgacgggccgcccgcctaccagctgctgtcg
tggacgacctttcccgagcgtctcgaagcacacggcgtgtcgtggcagatctaccagcag
ggcacgacgggcaacgatccgtacaacggcaactacggcacgaacgtgctgcagaacttc
gcgaacttcatcaacgcgaagcccggttcgtcgctgtaccagcgcgcgcagacggtgcgc
acactcgacaacctgaaggacgacgtgatcaacgaccggctgccgcaggtgtcgtggctg
tgcccgcccgcggcgttctccgagcatccgaaatacacgcccgcgtacggcgcgaactac
acgtcgcagatcctcgatgcgctcacgtcgaacccggacgtatggcgcaagaccgtgctg
ttcatcatgtacgacgagaacgacggcttcttcgaccacgtcgtgccgccgcagccgccg
acgtcggccgcgcagggcgcatcgaccgtcacgaccgacggcgagctgcacacggtcgtg
aaccccggtcgcggcggcagctacacggccgacggcctgccgtacggcctcgggccgcgc
gtgccgatgacggtcgtgtcgccgtggacgaaaggcggcttcgtgtgctcgcaggtgttc
gaccacacgtcggtgatccgcttcatcggcgagcgtttcggcatcgacgaaccgaacatc
acgccgtggcgtcgcacggtgtgcggcgacctcaccgccgccttcgacttccgctcgtcc
gacgcatcgttcccgccgctgcccgacacgagccagtaccgctcgatcgccgaccagcag
tgcacgtcgcagcccgcgccgacggtgcccgcgacgccgtcgccgatcgacccgcaggag
cccggcgtgcggccggcacgtgcgctgccgtacgagttgcacgtgaacgcaagcattgat
ggcggcaccaggctgcgcatcgagttcgcgaaccgcggcaaccagggcgcgcattttcac
gtgtattcgacgaaccgcaccgacggcccgtggcgctatacggtgggcgcgcgccgcgtg
ctacatgcggacttcgacctgaccgtgacgaacggggcatatacgttctcggtgtacggg
ccgaacggcttcgtgcgcgtgttctcgggcaacgtgtcggccccggccgcgccgcatcgc
aacccggcgcagccggaagtgaaggccggctacgacgtcgcgaacggcaacctgtacctg
aagctgcgcaaccctggcggggcccacgtcacgctgacgctgaccgacaacgcgtacggt
gcgccttcgcggcaagtcacgctgcatggcggcgacgagcgcgtcgagcagtgggcgctc
gcggcgagccaccaatggtatgacgtgacggtgagcgacggcgcggccggtaccttctcg
cgccgtttcgcgggccacgtcgagaacggccggccgagctattcggatccggcggcggta
cagcccgtctccgcggcgtaa

DBGET integrated database retrieval system