KEGG   Burkholderia lata: Bcep18194_B0048Help
Entry
Bcep18194_B0048   CDS       T00286                                 

Definition
(GenBank) L-arabinonolactonase
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
bur  Burkholderia lata
Pathway
bur00053  Ascorbate and aldarate metabolism
bur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Bcep18194_B0048
Enzymes [BR:bur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     Bcep18194_B0048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL PD40 Phytase-like
Motif
Other DBs
NCBI-ProteinID: ABB10165
UniProt: Q39BJ6
Position
2:53594..54496
Genome map
AA seq 300 aa AA seqDB search
MQQTHPAGQATLLADSRNTLGEGATWCDRTHALYWVDIEGAQLWRCRADGSDLTPWAMPE
RLACFALTHDPDVLLVGLATHLAFFDLRSGAFTRIVDVEPELPTRLNDGRCDPFGALVFG
MKDEGSEPPQAVGGFYRLNADLTLERLALPPAAIANSIAFSPDGSKLYFCDSLVREIFVC
DYRAGGDVANVRPFARLTDPDGDPDGSMIDRDGGLWNAQWGGRRVVRYGPDGVETDRVAV
PTAQPSCTALDGEGRLYVTSARIGLSDDALAGDPHAGGVFVAQTRHAGMATARFAGTPRG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagactcatccggccgggcaggcgacgctgctggccgacagccgcaacacgctc
ggcgaaggcgcgacgtggtgcgacaggacgcacgcgctgtattgggtggacatcgaaggc
gcgcaactgtggcgctgtcgcgcggacggctccgacctgacgccgtgggccatgcccgag
cggctcgcttgctttgcgctgacgcatgacccggacgtgctgctcgtcgggctcgcgacg
catctcgcgttcttcgacctgcgcagcggtgcgttcactcggatcgtcgacgtcgagccc
gagctgccgacgcggctcaacgacgggcgctgcgacccgttcggcgcactcgtgttcggg
atgaaggacgagggaagcgagccgccgcaggcagtcggcgggttctaccggctcaatgcc
gacctgacgctggagcggctcgcgttgccgccggccgcgatcgcgaacagcatcgcgttt
tcgccggacgggtcgaagctgtatttctgcgattcgctcgtgcgtgagatcttcgtctgc
gattaccgcgcgggcggagatgtcgccaacgtgcggccgttcgcgcggctgaccgatccc
gacggtgacccggacggctcgatgatcgatcgcgatggcggcctgtggaacgcgcagtgg
ggcggcaggcgtgtggtgcgctacgggcccgacggtgtcgagacggatcgcgtggccgta
ccgaccgcgcagccgagctgcacggcgctcgacggcgaaggccgcctgtacgtgacgagc
gcccgcatcgggttgagcgacgatgcgctggccggcgacccgcatgcgggcggcgtgttc
gtcgcgcagacgcggcacgcggggatggcgacggcgcggtttgcggggacgccgcgcggc
tga

DBGET integrated database retrieval system