KEGG   Burkholderia lata: Bcep18194_B0109Help
Entry
Bcep18194_B0109   CDS       T00286                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bur  Burkholderia lata
Brite
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Bcep18194_B0109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NmrA NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short DFP PALP Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ABB10226
UniProt: Q39BD5
Position
2:complement(116734..117741)
Genome map
AA seq 335 aa AA seqDB search
MTDTSRDLVLVTGASGFVGSAVARIAQQKGYAVRVLVRPTSPRTNVADLDAEIVTGDMRD
EASMRAALRGVRYLLHVAADYRLWAPDPDEIERANLEGAVATMRAARAEGVERIVYTSSV
ATLKVTSAGDPSDENRPLTAEQAIGVYKRSKVLAERAVERMIADEGLPAVIVNPSTPIGP
RDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAHGHFLALERGRIGERYILGGENL
PLQQMLADIAQMTGRKAPTIALPRWPLYPLAVGAEAVAKFTKKEPFVTVDGLRMSKNKMY
FTSAKAERELGYRARPYREGLRDALDWFGSAGYLK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacctcccgcgatctcgttctcgtcaccggcgcgtccggcttcgtcggctcg
gccgtcgcgcgcattgcgcagcagaaaggctatgcggtgcgcgtgctcgtgcgcccgacc
agcccgcgcacgaacgtggcggacctcgacgccgagatcgtcaccggcgacatgcgcgac
gaggcgtcgatgcgcgccgcgctgcgcggcgtgcgctacctgctgcacgtggcggccgac
taccggctgtgggcacccgatcccgacgagatcgagcgcgcgaacctcgagggcgcggtc
gcgacgatgcgcgcggcacgcgcggaaggcgtcgagcggatcgtctacacgagcagcgtc
gcgacgctgaaggtgacgagcgccggcgatccgtccgacgaaaaccggccgctcacggcc
gagcaggcgatcggtgtctacaagcgcagcaaggtgctcgcggaacgcgcggtcgagcgg
atgatcgccgacgaagggctgccggccgtgatcgtcaatccgtcgacgccgatcggcccg
cgcgacgtgaagccgacgcccaccggccgcatcatcgtcgaagccgcgctcggcaagatt
cccgcgttcgtcgacacggggctgaacctcgtgcatgtggacgacgtcgcgcacggccac
ttcctcgcgctcgagcgcggccggatcggcgagcgctacatcctcggcggcgagaacctg
ccgctgcagcagatgctcgccgacatcgcacagatgacgggccgcaaggcgccgacgatc
gcgctgccgcgctggccgctctacccgctcgcggtcggggcggaagcggtcgcgaagttc
acgaagaaggagccgttcgtcaccgtggacgggctgcggatgtcgaagaacaagatgtat
ttcacgtccgcgaaggccgagcgcgagctcggctaccgtgcgcgcccgtaccgcgaaggg
ctgcgcgatgcgctcgactggttcggctccgcgggctacctgaagtaa

DBGET integrated database retrieval system