KEGG   Burkholderia lata: Bcep18194_B0182
Entry
Bcep18194_B0182   CDS       T00286                                 
Name
(GenBank) Beta-lactamase-like protein
Organism
bur  Burkholderia lata
SSDB
Motif
Pfam: Lactamase_B Rhodanese Lactamase_B_2
Other DBs
NCBI-ProteinID: ABB10298
UniProt: Q39B63
Position
2:200346..201416
AA seq 356 aa
MIFRQLFDPQSSTYTYLLADRASREAVLIDPVFEQVRRDAALLDELGLRLVATVDTHVHA
DHVTGAWLLKQRTGSTIAISAASGAQGADRYLNDGDRCAFGARYLTVRATPGHTSGCISL
VLDDESMAFTGDCLLIRGTGRTDFQQGDPRALYRAVHGRLFTLPAACLLYPAHDYRGLTV
TSVGEERRFNPRLGGDLSEDDFAGYMRNLGLAHPRQIDVAVPANLQCGVAANAPDVQAAP
DWAPLVYTFAGFWEIDPQWLEDHLPAVQVVDVREPDEFTGPLGHLPGATPIPLGELAARA
GEIARDRPVVTVCRAGGRSAQATVILLKAGFDTVANLGGGMLRWRAEGRVVMDGRS
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgatcttccggcaactcttcgacccgcaatcgtcgacgtacacgtacctgctcgccgac
cgcgcgtcgcgcgaagcggtgctgatcgatcccgtgttcgagcaggtgcgccgcgacgcg
gcgctgctcgacgagctcgggctgcggctcgtcgcgaccgtcgacacgcacgtgcatgcc
gaccacgtgacgggcgcgtggctgctgaagcagcgcacgggcagcacgatcgcgatctcg
gccgcgagcggcgcgcagggcgccgatcgttatctgaacgatggcgaccgctgcgcgttc
ggcgcgcgctacctgaccgtgcgcgcgacgcccggccacacgagcggctgcatcagcctc
gtgctcgacgacgaatcgatggcgttcaccggcgattgcctgctgatccgcggcacgggc
cgtaccgacttccagcaaggcgacccgcgcgcgctgtatcgcgcggtgcacggccggctc
ttcacgctgccggccgcgtgcctgctgtatccggcgcacgactatcgcgggctcacggtg
acgagcgtcggcgaggagcggcgcttcaatccgcgtctcggcggcgatctgagcgaagac
gattttgcgggctacatgcgcaacctcgggctcgcgcatccgcgccagatcgacgtcgcg
gtgccggcgaacctgcagtgcggcgtcgctgcgaacgcgcccgatgtgcaggccgcgccc
gactgggcgccgctcgtctatacgttcgccgggttctgggaaatcgatccgcaatggctc
gaggatcacctgccggcggtgcaggtcgtcgacgtgcgcgagccggatgaattcacgggc
ccgctcggccacctgcccggcgcaacgccgattccgctcggcgaactggccgcacgcgcc
ggcgagatcgcgcgcgaccggccggtcgtgaccgtgtgccgggccggcggacgatccgcg
caggcgaccgtcattctgctgaaggccggcttcgatacggtggccaatctaggcggcggg
atgctgcgctggcgtgccgaaggccgcgtcgtaatggacggccggtcgtag

DBGET integrated database retrieval system