KEGG   Burkholderia lata: Bcep18194_B0197Help
Entry
Bcep18194_B0197   CDS       T00286                                 

Definition
(GenBank) Short-chain alcohol dehydrogenase
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
bur  Burkholderia lata
Pathway
bur00061  Fatty acid biosynthesis
bur00650  Butanoate metabolism
bur01100  Metabolic pathways
bur01120  Microbial metabolism in diverse environments
bur01200  Carbon metabolism
bur01212  Fatty acid metabolism
Module
bur_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcep18194_B0197
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Bcep18194_B0197
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bur01004]
    Bcep18194_B0197
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Bcep18194_B0197
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     Bcep18194_B0197
Lipid biosynthesis proteins [BR:bur01004]
 Fatty acid synthase
  Component type
   Bcep18194_B0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-ProteinID: ABB10313
UniProt: Q39B48
Position
2:complement(213092..214294)
Genome map
AA seq 400 aa AA seqDB search
MIIKPRVRGFICVTTHPVGCEANVKEQIDYVTSHGPIANGPKKVLVIGASTGYGLAARIS
AAFGSDADTLGVFFERAGSETKPGTAGWYNSAAFEKFATEKGRYARSINGDAFSDHVKQV
TIDTIKQDLGKVDLVVYSLAAPRRTHPKTGETISSTLKPIGKTVTFRGLDTDKEVLRDVT
LEPATQEEIDGTVAVMGGEDWQMWIDALDEAGVLADGAKTTAFTYLGEQITHDIYWNGSI
GEAKKDLDKKVLSIRDQLAAHGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKTMKETGT
HEGCIEQVYGLFKDSLYGATPHVDEEGRLRADYKELDPQVQAKVVAQWDHVTNDNLYELT
DFTGYKTEFLRLFGFEIAGVDYDADVNPDVKIPGIIDTTV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcaaaccgcgcgtgcgtggcttcatctgcgtgacgactcatccggtcggctgc
gaagccaacgtcaaggaacagatcgactacgtgacttcgcacggcccgatcgccaacggc
ccgaaaaaggtgctcgtgatcggcgcgtcgaccggctacggcctcgccgcccggatctcg
gccgccttcggctcggacgcggacacgctcggcgtgttcttcgagcgcgccggcagcgaa
acgaagccgggcacggcaggctggtacaacagcgccgcgttcgagaaattcgccaccgaa
aaggggcgctatgcgcgcagcatcaacggcgacgcattctccgaccacgtgaagcaggtc
acgatcgacaccatcaagcaggatctcggcaaggtggacctcgtcgtctacagcctcgcg
gcaccgcgccgcacgcatccgaagacgggcgaaaccatcagctcgacgctcaagccgatc
ggcaagacggtcacgttccgcggcctcgacaccgacaaggaagtgctccgcgacgtcacg
ctggaaccggcgacgcaggaagagatcgacggcaccgtcgccgtgatgggcggcgaggac
tggcagatgtggatcgacgcgctcgatgaagccggcgtgctggccgacggcgcgaagacc
accgcgttcacgtatctcggcgagcagatcacgcacgacatctactggaacggctcgatc
ggcgaagcgaagaaggatctcgacaagaaagtgctgtcgatccgcgaccagctggccgca
cacggcggcgacgcgcgcgtgtcggtgctgaaggccgtcgtcacgcaggccagctcggcg
atcccgatgatgccgctgtacctgtcgctgctgttcaagacgatgaaggaaaccggcacg
cacgaaggctgcatcgagcaggtgtacggcctgttcaaggacagcctgtatggcgcgacg
ccgcacgtcgacgaagaaggccgcctgcgcgcggactacaaggagctcgatccgcaagtt
caggcgaaggtcgtcgcgcagtgggaccacgtgacgaacgacaacctgtacgagctgacc
gacttcaccggctacaagaccgagttcctgcgcctgttcggcttcgagatcgccggcgtc
gactacgacgcggacgtgaacccggacgtgaagatcccgggcatcatcgacaccactgtc
tga

DBGET integrated database retrieval system