KEGG   Burkholderia lata: Bcep18194_B0328Help
Entry
Bcep18194_B0328   CDS       T00286                                 

Definition
(GenBank) 2,5-dioxopentanoate dehydrogenase (NAD+)
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
bur  Burkholderia lata
Pathway
bur00040  Pentose and glucuronate interconversions
bur00053  Ascorbate and aldarate metabolism
bur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcep18194_B0328
   00053 Ascorbate and aldarate metabolism
    Bcep18194_B0328
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     Bcep18194_B0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABB10444
UniProt: Q39AR7
Position
2:353326..354903
Genome map
AA seq 525 aa AA seqDB search
MQLTGEMLIGADAVAGSAGTLRAFDPSKGAPIDAPAFGVATQADVERACELARDAFDAYR
AQPLAARAAFLDAIADEIVALGDALIERAHAETGLPVARLQGERGRTVGQLRLFARVVRD
GRFLAASIDPAQPARTPLPRSDLRLQKVGLGPVVVFGASNFPLAFSVAGGDTASALAAGC
PVIVKAHEAHLGTSELVGRAIRAAVAKTGMPAGVFSLLVGPGRVIGAALVSHPAVQAVGF
TGSRQGGMALVQLANARPQPIPVYAEMSSINPVVLFPAALAARGDAIATGFVDSLTLGVG
QFCTNPGLVLAIDGPDLDRFETVAAQALAKKPAGVMLTRGIADAYRNGRGKLAELPGVRE
IGAGEAAQTDCQAGGALYEVGAQAFLAEPAFSHEVFGPASLIVRCRDLDEVARVLEALEG
QLTATLQMDADDKPLARRLLPILERKAGRLLVNGYPTGVEVCDAMVHGGPFPATSNPAVT
SVGATAIDRFLRPVCYQDFPDDLLPEGLQESNPLAIPRLRDGKAE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgactggagagatgctgatcggcgccgacgcggtggccggctcggccggtacc
ttgcgcgcgttcgacccgtcgaagggcgcgccgatcgacgcgccggcattcggcgtcgcg
acgcaggccgacgtcgagcgcgcatgcgaactcgcacgtgatgcgttcgacgcgtaccgc
gcgcagccgctcgcggcccgcgcggcgtttctcgacgcgatcgcggatgaaatcgtcgcg
ctcggcgacgcgctgatcgagcgcgcccacgccgaaacgggcctgcccgtcgcgcggctg
cagggcgagcgcggccgcaccgtcggccagctccggctgttcgcgcgcgtcgtgcgcgac
gggcgcttccttgccgcgtcgatcgatcccgcgcagccggcgcgcacgccgctgccgcgc
tcggacctgcggctgcagaaagtcgggctcgggcccgtcgtcgtgttcggtgcgagcaat
ttcccgctcgcgttctcggtggccggtggcgatacggcgtcggcgctcgcggctggctgc
ccggtgatcgtgaaggcgcacgaggcgcacctcggcacgtccgagctggtcggccgcgcg
atccgtgccgccgtcgcgaaaaccggcatgccggcgggcgtgttctcgctgctggttggc
cccggccgcgtgatcggtgcggcgctcgtcagccatccggcggtccaggcggtcggcttc
acggggtcgcggcagggcggcatggcgctcgtgcagctcgcgaacgcccgcccgcagccg
attcccgtctacgcggaaatgagcagcatcaaccccgtcgtgctgttcccggcggcgctc
gccgcgcgcggcgacgcgatcgcgacgggcttcgtcgattcgctgacgctcggcgtcggc
cagttctgtaccaacccgggcctcgtgcttgcgatcgacggccccgatctcgaccgtttc
gaaaccgtcgccgcgcaggcgcttgcgaagaagccggccggcgtgatgctcacgcgcggc
atcgccgatgcgtatcgcaacggtcgcggcaagctggccgaactaccgggcgtgcgtgag
atcggcgcgggcgaggcggcgcagaccgactgccaggccggcggcgcgctgtacgaagtc
ggcgcgcaggcgttcctggccgaaccggcgttcagccacgaggtgttcggtccggcgtcg
ctgatcgtgcgttgccgcgatctcgacgaagtcgcgcgcgtgctcgaagcgctcgaaggc
cagctgacggccacgctgcagatggacgctgacgacaaaccgctcgcgcgccggctgctg
ccgatcctcgaacgcaaggcgggccgcctgctggtcaacggctacccgaccggcgtcgag
gtgtgcgacgcgatggtgcacggcgggccgttcccggctacgtcgaacccggccgtcacg
tcggtcggcgcgacggcgatcgaccgtttcctgcggcccgtgtgctaccaggatttcccg
gacgatctgctgccggaagggctgcaggaaagcaatccgctcgcgattccgcggctgcgg
gacgggaaggcggagtga

DBGET integrated database retrieval system