KEGG   Burkholderia lata: Bcep18194_B0564Help
Entry
Bcep18194_B0564   CDS       T00286                                 

Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bur  Burkholderia lata
Pathway
bur00625  Chloroalkane and chloroalkene degradation
bur00680  Methane metabolism
bur01100  Metabolic pathways
bur01120  Microbial metabolism in diverse environments
bur01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Bcep18194_B0564
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcep18194_B0564
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Bcep18194_B0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP FAD_binding_3 XdhC_C 2-Hacid_dh_C Glutaredoxin HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABB10678
UniProt: Q39A33
Position
2:629991..631187
Genome map
AA seq 398 aa AA seqDB search
MSSNRGVVYLGPGQVEVQKIDYPKMVDPSGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVVEIGRDVETLKLGDLVSVPFNVACGRCAMCKDTHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDQAMSKIRDLTCLSDILPTGYHGAV
SAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNAERLAHARAMGFETVDLSKD
ASLGEQIEQILGVPEIDCAVDCVGFEAHGHGSSGHSEEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAKDKAAQHGSLSIRFGLGWAKSHSFFTGQTPVLKYNRNLMQAILFDRLPIA
KIVNVEVISLDQAPEGYKKFDGGAPRKFVIDPHGLLAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgaggtgtcgtctatcttggaccgggtcaggtcgaagtccagaaaatc
gattatccgaagatggtcgatccgagcggccgtgcgatcggccacggcgtgatcctcaaa
gtggtcagcacgaacatctgcggttccgaccagcacatggtgcgcggccgcacgaccgcg
ccggtcggcctcgtgctcggtcacgagatcacgggcgaggtggtcgagatcggccgcgac
gtcgagacgctgaagctcggcgatctcgtgtcggtaccgttcaacgtggcgtgcggccgc
tgtgcgatgtgcaaggacacgcatacgggcgtgtgcctgaacgtgaacccgtcgcgtgcg
ggtggcgcgtacggttacgtcgacatgggcggctggatcggtggccaggccgagtacgtg
ctcgtgccgtacgcggatttcaacctgttgaaattccccgatcgtgatcaggcgatgtcg
aagatccgcgatctgacctgcctgtccgacattctgccgaccggttatcacggtgcggtg
agcgcgggcgtgaagccgggctcgacggtctatatcgcgggcgcgggcccggtcgggatg
gcggcggccgcatcggcgcgcttgcttggcgcggccgtgacgatcgtcggcgacatgaac
gcggaacgccttgcgcacgcacgggcgatgggcttcgagacggtcgacctgtcgaaggac
gcctcgctcggcgagcagatcgagcagatcctcggcgtgcccgagatcgactgcgcggtc
gactgcgtcggtttcgaggcgcacggccacggttcgtcgggccattcggaagaagcgccc
gcgacggtgctgaactcgctgatggaaatcacgcggccggccggcgcgatcggcatcccg
ggcctgtacgtgacggacgatccgggcgcgaaagacaaggccgcgcagcacggtagcctg
agcatccgcttcggcctcggctgggcgaagtcgcactcgttcttcacgggccagacgccg
gtgctgaagtacaaccgcaacctgatgcaggcgatcctgttcgaccggctgccgatcgcg
aagatcgtcaacgtcgaagtgatctcgctcgaccaggcaccggaaggctacaagaagttc
gatggcggcgcgccgcgtaaattcgtcatcgatccgcacgggttgctggcggcgtaa

DBGET integrated database retrieval system