KEGG   Burkholderia lata: Bcep18194_B0610Help
Entry
Bcep18194_B0610   CDS       T00286                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bur  Burkholderia lata
Pathway
bur00630  Glyoxylate and dicarboxylate metabolism
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur01120  Microbial metabolism in diverse environments
bur01200  Carbon metabolism
Module
bur_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bcep18194_B0610
Enzymes [BR:bur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bcep18194_B0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABB10724
UniProt: Q399Y7
Position
2:complement(682592..684175)
Genome map
AA seq 527 aa AA seqDB search
MAQYQDDIKAVAGLKENHGSAWNAISPEYAARMRAQNKFKTGLDIAKYTAKIMRADMAAY
DADPAKYTQSLGCWHGFIGQQKMISIKKHFNSTERRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIRELYTFLRQADARELGGLFRELDAAKDATAKAAIQDKIDNHVTHVVPIIA
DIDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRAI
RYAFLELGVDDGIIVARTDSLGAGLTKQIAVTSTPGDLGDQYNAFLDCEELSADQLGNGD
VVIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCITSLQNGADLLWIETEKPHIAQIGG
MVSEIRKVIPNAKLVYNNSPSFNWTLNFRQQAYDALKAEGKDVSAYDRAQLMSVEYDETE
LAKLADEKIRTFQADAAREAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVAGVQ
RKEIRQGIACVKHQNMSGSDIGDDHKEYFSGDAALKAAGKDNTMNQF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtatcaagacgacatcaaggcagttgccggtttgaaagaaaaccacggcagc
gcgtggaatgcgatcagccccgagtacgctgcccgcatgcgtgcccagaacaagttcaag
acgggcctggacatcgccaagtacaccgcgaagatcatgcgcgccgacatggccgcctac
gacgccgacccggccaagtacacgcagtcgctgggttgctggcacggcttcatcggccag
cagaagatgatctccatcaagaagcacttcaacagcaccgaacgccgctacctgtacctg
tccggctggatggtcgctgcgctgcgttccgagttcggcccgctgccggaccagtcgatg
cacgaaaagacctcggtcagcgcgctgatccgcgagctgtacacgttcctgcgccaggcc
gacgcccgtgaactgggcggcctgttccgcgagctcgacgccgccaaggacgccacggcg
aaggcagcaatccaggacaagatcgacaaccacgtcacgcacgtcgtgccgatcatcgcc
gacatcgacgccggtttcggcaacgcggaagccacgtacctgctggccaagcaattcatc
gaagcaggcgcatgctgcatccagatcgaaaaccaggtgtccgacgagaagcagtgcggc
caccaggacggcaaggtcaccgtgccgcacgaggacttcctcgcgaagatccgcgcgatc
cgctacgcgttcctggaactgggcgtggacgacggcatcatcgtggcccgtaccgactcg
ctcggcgccggcctgaccaagcagatcgccgtgaccagcacgccgggcgacctgggcgac
cagtacaacgcgttcctcgattgcgaagaactgtcggccgaccaactgggcaacggtgac
gtcgtcatcaagcgcgacggcaagctgctgcgtccgaagcgcctgccgagcaacctgttc
cagttccgcgccggcacgggcgaagcgcgctgcgtgctcgactgcatcacgtcgctgcag
aacggcgccgacctgctgtggatcgaaaccgaaaaaccgcacatcgcacagatcggcggc
atggtcagcgagatccgcaaggtcatcccgaacgcgaagctggtgtacaacaacagcccg
tcgttcaactggacgctgaacttccgtcagcaggcgtacgacgcgctgaaggccgagggc
aaggacgtgtcggcctacgaccgtgcgcagctgatgagcgtggaatacgacgagacggaa
ctggccaagctggccgacgagaagatccgtacgttccaggccgacgcagcgcgtgaagca
ggcatcttccatcacctgatcacgctgccgacgtaccacaccgccgcgctgtcgaccgac
aacctggccaaggaatacttcggcgaccagggcatgctgggctacgtggccggcgtgcag
cgcaaggaaatccgccagggtatcgcctgcgtgaagcaccagaacatgtccggttcggac
atcggtgacgatcacaaggaatacttcagcggcgacgcagcgctgaaggcagcaggcaag
gacaacacgatgaaccagttctga

DBGET integrated database retrieval system