KEGG   Burkholderia lata: Bcep18194_B0825Help
Entry
Bcep18194_B0825   CDS       T00286                                 

Definition
(GenBank) Cytidyltransferase-related protein
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
bur  Burkholderia lata
Pathway
bur00760  Nicotinate and nicotinamide metabolism
bur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Bcep18194_B0825
Enzymes [BR:bur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     Bcep18194_B0825
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     Bcep18194_B0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like NUDIX_4 FAD_syn
Motif
Other DBs
NCBI-ProteinID: ABB10939
UniProt: Q399C2
Position
2:932799..933839
Genome map
AA seq 346 aa AA seqDB search
MSTQQNRRFDALVFIGRFQPPHRGHLNVLKSALSRAERVCVLIGSTDKPRTIKDPFSFDE
RRQMLASLLDASERDRVTIAPLQDSTYNDGDWVRWVQDAVASALGDIAQRKVGLIGHEKD
ATSYYLRMFPQWELVDVDATEDISATEIRDQYFAERPNSFVQWAVPEPVFGWLERFRSQP
EFAQLKSEAEFIAGYHKAWAAAPYPVTFVTVDAVVVHSGHILLVRRRSEPGRGLWALPGG
FVNQDERLDAACIRELREETGLKLPEPVLRGSIKDRQVFDHPTRSLRGRTITHACLFNFP
TGELPRVKGSDDADKARWVPLNEFAQMRGVMFEDHFDIAYHFLGKL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcaacagaaccggcgcttcgacgcgctcgttttcattggtcgtttccagcct
ccgcatcgcggtcacctgaatgtgctgaagtcggcactgagccgggccgagcgcgtgtgc
gtgctgatcggatcgaccgacaagccccgcaccatcaaagatccgttctcgttcgacgag
cgccgccagatgctggcttcgctgctcgacgcgtccgagcgcgaccgcgtcaccatcgcg
ccgttgcaggattcgacctacaacgacggcgactgggtgcgctgggtgcaggacgccgtc
gcgtccgcgctcggcgatatcgcgcagcgcaaggtcgggctgatcggccacgagaaggac
gccacgtcgtattacctgcggatgttcccgcaatgggagctcgtcgacgtcgacgcgacg
gaagacatttccgccaccgagatccgcgaccagtatttcgctgaacgccccaacagcttc
gtacagtgggccgtgccggaacccgtgttcggctggctcgagcgtttccggtcgcagccg
gaattcgcgcagctgaagtcggaagccgaattcatcgccgggtatcacaaggcgtgggcg
gcggcgccgtatccggtcacgttcgtgacggtcgacgcggtggtcgtgcactcgggccat
atcctgctcgtgcgccgccgcagcgagccgggccgcggcctgtgggcgctgcccggcggg
ttcgtgaaccaggacgagcggctcgacgcggcctgtatccgcgaactgcgcgaggaaacc
ggcctgaagctgccggagcccgtgctgcgcggctcgatcaaggatcgccaggtgttcgat
cacccgacgcgttcgctgcgtggccgcacgatcacgcatgcgtgcctgttcaatttcccg
accggcgagctgccgcgcgtgaagggcagcgacgatgccgacaaggcacgctgggtgccg
ctgaacgaattcgcgcagatgcgcggcgtgatgttcgaggatcacttcgacatcgcgtat
cacttcctggggaagctgtga

DBGET integrated database retrieval system