KEGG   Burkholderia lata: Bcep18194_B0982Help
Entry
Bcep18194_B0982   CDS       T00286                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bur  Burkholderia lata
Pathway
bur03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bur00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcep18194_B0982
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bur02044]
    Bcep18194_B0982
Secretion system [BR:bur02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep18194_B0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ABB11096
UniProt: Q398L5
Position
2:1098922..1099407
Genome map
AA seq 161 aa AA seqDB search
MSQDIFLKIDGINGESLDDKHKDEIEILNWDWEIQQESSMHSGSGGGAGKATVKDLTFEH
NIDRASPNLMKYALTGKHIDQAVLVMRKAGGNPLEYLKLTMSDVIVTRVKPSGSKAGEEK
SRETVSLSFSKVKQEYVVQNAQGGSGGAVTASFDIKGNKEA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaggacatttttctgaagatcgacggcatcaacggtgaatcgctcgatgacaag
cacaaggacgaaatcgagatcctgaactgggactgggaaatccagcaggaatcgtcgatg
cactcgggcagcggcggcggtgccggcaaggcaacggtcaaggatctcacgttcgaacac
aacatcgaccgtgcgagcccgaacctgatgaagtatgcgctgacgggcaagcacatcgac
caggccgtgctggtgatgcgcaaggccggcggcaatccgctcgagtacctgaagctcacg
atgagcgacgtgatcgtcacgcgcgtgaagccgtccggcagcaaggccggtgaagagaag
agccgcgagacggtgtcgctgtcgttctcgaaggtcaagcaggagtatgtcgtgcagaac
gcgcagggcggcagcggcggcgccgtcacggcgagcttcgacatcaagggcaacaaggaa
gcgtaa

DBGET integrated database retrieval system