KEGG   Burkholderia lata: Bcep18194_B1188Help
Entry
Bcep18194_B1188   CDS       T00286                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
bur  Burkholderia lata
Pathway
bur00360  Phenylalanine metabolism
bur00362  Benzoate degradation
bur00621  Dioxin degradation
bur00622  Xylene degradation
bur01100  Metabolic pathways
bur01120  Microbial metabolism in diverse environments
bur01220  Degradation of aromatic compounds
Module
bur_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Bcep18194_B1188
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcep18194_B1188
   00622 Xylene degradation
    Bcep18194_B1188
   00621 Dioxin degradation
    Bcep18194_B1188
Enzymes [BR:bur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     Bcep18194_B1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm DUF3866
Motif
Other DBs
NCBI-ProteinID: ABB11302
UniProt: Q397Q9
Position
2:1336527..1337594
Genome map
AA seq 355 aa AA seqDB search
MNDARKKLYISDVTLRDGSHAIRHQYSIANVKAIAAALDRAGVDSIEVAHGDGIEGSSFN
YGFGAHSDVEWIEAAAASVKHAKIATLLIPGIGTIHDLRNAYDAGARVVRVATHCTEADV
SRQHLEYAREIGMDPVGFLMMSHMTTPQKLAEQAKLMESYGATCVYVVDSGGALGMNDIR
DRFRAFKEALKPETQTGMHAHHNLSLGVANSLVAVEEGCDRIDASLAGMGAGAGNAPLEV
FIAAAERQGWHHGCDLYGLMDAADDIVRPLQDRPVRVDRETLALGYAGVYSSFLRHAERA
ADKYGLKTVDILVELGRRKMVGGQEDMIVDVALDLLKSAEHERTHAEPTMSEAGR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgcacgcaagaagctctatatttccgatgtgaccttgcgcgacggaagtcat
gcgatccgccatcagtacagcatcgcgaacgtgaaagcgatcgcggccgcgctggatcgc
gcgggggtcgacagcatcgaggtcgcgcacggcgacggcatcgagggctcgagtttcaac
tatggtttcggcgcacactccgacgtcgaatggatcgaagcggcggccgcgagcgtgaag
cacgcgaaaatcgccacgctgctgattcccggcatcgggacgatccacgatctgcgtaac
gcgtacgatgccggcgcgcgcgtggtgcgcgtggcgacgcactgtaccgaagcggacgtg
tcgcggcagcatctggaatacgcccgcgagatcggcatggatccggtcggtttcctgatg
atgagccatatgacgacgccgcaaaagctcgcggaacaggcgaagctgatggaaagttac
ggcgcgacctgcgtgtatgtggtcgattccggcggcgcactcggcatgaacgatatccgc
gaccgcttccgcgcgttcaaggaggcgttgaagcccgagacacagacgggcatgcatgcg
caccacaacctgagcctgggcgttgcgaactcgctggtggcggtcgaggagggatgcgac
cgcatcgacgcgagtctcgccgggatgggggcgggcgcgggcaatgcgccgctcgaggtg
ttcatcgcagctgccgagcgccagggatggcatcacggctgcgacctgtacggcctgatg
gatgcagccgacgacatcgtgcgcccgctgcaggaccggccggtccgtgtcgatcgcgag
acgctcgcgctgggctacgccggcgtgtattcgagcttcctgcgccatgccgagcgcgcg
gcggacaagtacggcctgaagaccgtcgatatcctcgtcgaactcggccgccggaagatg
gtgggcgggcaggaggacatgatcgtcgacgtcgcgctcgatctgctgaagtcggccgag
cacgaacgcacgcatgccgagccgacgatgagcgaagcggggcgttga

DBGET integrated database retrieval system