KEGG   Burkholderia lata: Bcep18194_B1584
Entry
Bcep18194_B1584   CDS       T00286                                 

Definition
(GenBank) protein of unknown function DUF879
  KO
K11896  type VI secretion system protein ImpG
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bur02044]
    Bcep18194_B1584
Secretion system [BR:bur02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep18194_B1584
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABB11698
UniProt: Q396B3
Position
2:complement(1800285..1802156)
AA seq 623 aa
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRLNESGPPDPYVERLLEGFSFLTARV
QLKMDAEFPRFTQALLDAVYPGYIAPLPSMAIVRFAPMLNEGSLAQGWRLPAGTALRARP
AASEQTACEFRTAHDLTLWPLELTDATVTGAPSWLPRGAFAARQDVRGALRIRLKVRGGA
KLSQLPLDRLTFHLAGPERDALHLLELIAAHALGVVCHDPAQPPRWLHTLDADEIVHEGF
DPAQAILPDDGRSFHGYRLLREYFAFPARFLFFSIGGLRAALARATGDEFELTVLFDRHD
AALEAAVSAKHLALNCTPAVNLFARRADRIPLQPGAREHHVVVDRSRPLDYEVYAVQRLA
SEQRDDGQSREFRPFHASFATDDGNHGAYYMVRREPRLVSSQARANGTRTGYVGSETYVS
LVDSQCAPYDETMRYLAADTLCTNRDLVLLQPPGDANTFTLRVSAPVESIVAIRGPSRPR
PPIADAQTAWRLIRHLGLARHTLTDLDDDEGAHALRELLGLHADPADAAMRRQIDGVLRV
AFSPVFRRLPASGPLMFGRGVQVDVTVDDHAFSGDSPFLLGAVLEQFFARHVSINAFAEC
VLTSAQRGQLAHWPARIGRRPAI
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggatacgcgcctgctcgactactacaaccgcgaactcgcgtacctgcgcgagctcggc
ggcgaattcgcgcagcagttcccgaaagtggccgcgcggctgcggctcaacgaatcgggg
ccgcccgacccgtacgtcgagcggctgctagaaggcttcagctttctcaccgcgcgcgtg
cagctcaagatggacgccgagtttccgcgcttcacgcaggcgttgctcgatgccgtgtat
cccggctacatcgcgccgctgccgtcgatggcgatcgtgcggttcgcgccgatgctgaac
gaaggcagcctcgcacaaggctggcggctgccggccggcaccgcgctgcgcgcgcgtccg
gccgcatccgagcagaccgcgtgcgaattccgcaccgcgcacgacctgacgctgtggccg
ctcgaactgaccgatgcgaccgtcaccggcgcgccgtcgtggctgccgcgtggcgccttc
gccgcccggcaggacgtgcgcggcgcgctgcgcatccggctgaaggtgcgcggcggtgcc
aaactgtcccagttgccgctcgaccggctgacgttccatctcgcgggccccgagcgcgac
gcactgcacctgctcgaactgatcgccgcgcatgcgctcggtgtcgtgtgccacgatccc
gcgcagccgccgcgctggctgcatacgctcgacgccgacgagatcgtccacgaaggcttc
gatcccgcccaggcgatcctgcccgacgacggccgcagcttccacggctaccggctgctg
cgcgagtatttcgcgtttccggcgcgcttcctgttcttcagcatcggcgggctacgcgcc
gcgctcgcacgcgcaaccggcgacgagttcgagctgaccgtgctgttcgaccgccatgac
gcggcactcgaagcggccgtcagcgcgaaacacctcgcgctgaactgcacgccggccgtg
aacctgttcgcgcgccgtgccgaccgcattccgctgcaaccgggcgcgcgtgagcaccat
gtcgtcgtcgatcgcagccggccgctcgactacgaggtctatgcagtgcagcggctcgcg
agcgagcagcgcgacgacggccagtcacgcgaattccggccgtttcatgcgtcgttcgcg
accgacgacggcaaccacggcgcgtactacatggtgcgacgcgaaccgaggctggtctcc
tcgcaggcacgtgcgaacggcacgcgcaccggctacgtcggcagcgagacctacgtgtcg
ctcgtcgacagccagtgcgcgccgtacgacgagacgatgcgctacctggcggccgacacg
ctgtgcacgaaccgcgacctcgtgctgctgcagccgcccggcgacgcgaacacgttcacg
ctgcgcgtgtcggccccggtcgaaagcatcgtcgcgatccgcggcccgtcgcggccgcgc
ccgccgatcgccgatgcgcaaaccgcgtggcggctgatccgccatctcgggctggcccgg
cacacgctgaccgatctcgacgacgacgagggcgcgcatgcgctgcgcgaactgctcggc
ctgcatgccgacccggccgatgccgcaatgcgccggcagatcgacggcgtgctgcgtgtg
gcgttctcgccagtgttccgccggctgccggcgtcaggcccgctgatgttcgggcgcggc
gtgcaggtcgacgtgaccgttgacgaccatgcgttctccggtgacagcccgttcctgctc
ggcgcggtgctcgaacagttcttcgcgcgccacgtgtcgatcaacgcgttcgccgaatgc
gtgctgaccagcgcgcagcggggccagctcgcccactggccggcgcgcatcggcaggcgg
cccgcgatatga

DBGET integrated database retrieval system