KEGG   Burkholderia lata: Bcep18194_B1586Help
Entry
Bcep18194_B1586   CDS       T00286                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K06887  uncharacterized protein
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Bcep18194_B1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ABB11700
UniProt: Q396B1
Position
2:complement(1802726..1803217)
Genome map
AA seq 163 aa AA seqDB search
MGVAMFMKVDGVTGESADAQHKGWTDIQSFTWGASQPGAMASGSGGNAGKASFNDLVVAA
YMDKGAPAIIKNCANGKHLSTVEISACKTGGTQVEFMRVTLQEVLVTSAQVAGIDPGDVA
DRLMMHYGFQAAKVKKQYWQQNDNGGKGAEVTVGWNIKENTEM
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtggcaatgtttatgaaggtggacggcgtgaccggcgaatcggcggacgcacag
cacaagggctggaccgacatccagtcgttcacgtggggcgcgagccagccgggcgcgatg
gcgagcggcagcggcggcaatgcgggcaaggcgagcttcaacgatctcgtcgtcgccgcg
tacatggacaagggtgcacccgcgatcatcaagaactgcgcgaacggcaagcacctttcg
acggtcgagatctccgcgtgcaagacgggcggcacgcaggtcgagttcatgcgcgtgacg
ctgcaggaagtgctcgtcacgtccgcgcaggtcgcgggcatcgatccgggcgacgtcgcc
gaccggctgatgatgcactacggcttccaggccgcgaaggtgaagaagcagtactggcag
cagaacgacaacggcggcaagggcgcggaggtgaccgtcggctggaacatcaaggaaaac
accgagatgtga

DBGET integrated database retrieval system