KEGG   Burkholderia lata: Bcep18194_B1589
Entry
Bcep18194_B1589   CDS       T00286                                 

Definition
(GenBank) conserved hypothetical protein, ImpA-like protein
  KO
K11902  type VI secretion system protein ImpA
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bur02044]
    Bcep18194_B1589
Secretion system [BR:bur02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep18194_B1589
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: ABB11703
UniProt: Q396A8
Position
2:complement(1805418..1806533)
AA seq 371 aa
MHSNDVSQAALAAAALSTVPPGLPATPRADLIGQLLAEVAPDAPCGANLEYDAEFLQLQE
RATPRAEQQYGDTVIPAEAPDWRAVERLALALSARTKDLRVIACLARSWTEQHGIPGYAD
ALALVANLLARCWDDLHPRLDADGDPDPTLRMNALAEMAGAHDCARAARRQPLFDGGPSV
RDAERLLDGRDDTGSPVAGSRESLLAALSATRSDGTTPLDAARAALHALEAIRVCVTDKL
GREWAPDEGDAEKALQRIVREVPLPEPQQVSPDLQQAAPGDASQAGTTATAPTAMPNAHA
WRDAEVTSRDDVRIGLDKMCRYFEQHEPSHPAPLLLRRAQRLLTLDFYEIIRDLAPESLP
KLDLLSGERSE
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgcattcgaatgacgtcagccaggcggcgctggccgccgccgcattgtccacggtgccg
cccggcctgccggcgaccccgcgcgccgacctgatcggccagctgctcgcggaggtcgcg
cccgatgcgccgtgcggcgcgaacctcgaatacgacgccgagttcctgcaactgcaggag
cgcgcgacgccgcgcgccgagcagcaatacggcgacacggtgatcccggccgaggcgccc
gactggcgtgcggtcgagcggctcgcgcttgcgctgtccgcgcgcacgaaggatctgcgc
gtcatcgcctgtctcgcgcgaagctggaccgagcaacacggcattcccggctatgcggac
gcgctcgcgcttgtcgcgaacctgctcgcgcgctgctgggacgacctgcatccgcggctc
gacgcggacggcgacccggacccgacgctgcgtatgaacgcgctcgccgagatggccggc
gcgcacgactgcgcgcgcgcggcgcgccgccagccgctgttcgacggcgggccgagcgtg
cgcgacgcggaacggctgctcgacggccgcgacgataccggcagccccgtggcgggcagc
cgcgaaagcctgctggctgcgctgtcggctacgcgtagcgacggcacgacgccgctcgac
gcggcgcgcgcggcattgcacgcgctggaggcgatccgcgtgtgcgtgacggacaaactg
ggccgtgaatgggcacccgacgaaggcgatgcggagaaagcgctgcagcggatcgtgcgc
gaagtgccgctgccggagccgcaacaggtgtcgcccgacctgcagcaggccgcgcccggc
gacgcatcgcaggcaggcacgacagctaccgcgccaacagcaatgccgaacgcccacgcc
tggcgcgatgccgaggtcacgagccgcgacgacgtgcgcatcggtctcgacaagatgtgc
cgctatttcgagcagcacgaaccgagccacccggcgccgttgctgctgcggcgcgcccag
cggctgctcacgctcgacttctacgaaatcatccgcgatctcgcaccggagagcctgccg
aagctggacctgctgagcggcgagcggagcgaatga

DBGET integrated database retrieval system