KEGG   Burkholderia lata: Bcep18194_B1592
Entry
Bcep18194_B1592   CDS       T00286                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
bur  Burkholderia lata
Pathway
bur03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bur00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcep18194_B1592
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bur02044]
    Bcep18194_B1592
Secretion system [BR:bur02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep18194_B1592
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C BTP
Other DBs
NCBI-ProteinID: ABB11706
UniProt: Q396A5
Position
2:complement(1809587..1813213)
AA seq 1208 aa
MNQAVARFVRPLPSREIWTFAGLVVLACFVWLAGPLFAFAEVRPLESGWARGLTIAVLFI
AWGARVAWRSWRAGRLNAQLLNQLREAAPGPATADDPAKAQLDELRSRFDEAASLLKKVR
FGQADTVRKGLPRWFDRMSRQYLYQLPWYVFIGAPGSGKTTALVNSGLSFPLAEQFGRAA
IRGVGGTRHCDWWFTNDAVLIDTAGRYTTHEGNRALDEAEWKGFVDLLKKYRTRQPLNGA
MLTISVADLLGASEAERTQHAMVLRKRLLELRAQLGIRFPVYLLVTKADLLAGFAEYFSS
YGRTECAQVWGFTFPLAQSEAPGFDLRAAFDREYRLLHQRLNDGLPELLAAQTDARQREM
TYLLPQQIADLQDMLGQFVAEVFSVSSYEPMPMLRGVYLTSGTQEGTAFDRVMSGIKRFL
KIEGVPPVAQVGSTGRSFFLKSLLQEHIFREAALAGSDLRWHQKRRVLQIVGYVLLALVC
VAVLVAWLRSYSNNRAYLDQIAARVPAVDAQIAGAKFSDAADVARLLPVLDALGNLANAG
GVDLQHPPLAYRWGLFQGEKIDEAVDAVYRRALEDVLLPIAARRMEAALRDARPDETEYA
YAALKAYLMLYDSAHYDPAFVQAVVDLEMERALPPDFSPAERTALRAHLAALFGNRVAVS
PYPMNERLVADVRDRLRQVPFSQRLYRQLTLTLRPATSAFDFSVARAVGPDASLVFRRQS
GKPLSEGVPGLYTRNGYRNVFAPRLAGEVDTYGREEVWVLNLGLSEIPGPNDAAAWARDI
RQLYLNDYLKIWDDYLADIKLQRTATLAQSIQVARALSSADSPLTRLMVALARDTALGDA
PGGARNLAARAQDKVDEARSSLSQIFAGQGSDSSASAAAPASAEQIVDSHFAGLRAFAPG
SGDQAQAFSEVLKSIDALYTYLTATDDALRSGAQPPPSDAPARLRAQAGRLPTPFREVLD
DLSNVANGSVATVEQRSVATRAGANVGDFCRQAIAGRYPFARGSSRDVAPADFAQMFAPG
GLMDDFFQKNLQSIVDTTSHPWRFANRNADADPSAAAMLASFEKAAVIRDAYFGGGARTA
QLKVQIQPLEMDPSITEMVLDVDGQIVRYAHGPLVQSAVDWPGPRGSNQVRLQVSGQAGA
TDGFSTDGPWALHRLFDRAAVSAGRGSDQMIARFTVDGKPIVLQVNAGSVRNPFRLPQME
SFTCPPKP
NT seq 3627 nt   +upstreamnt  +downstreamnt
atgaaccaggctgtcgcgcgtttcgtccggccgttgccgtcgcgggagatctggactttc
gccggtctcgtcgtgctcgcgtgcttcgtgtggctcgcaggcccgctgttcgcgttcgcc
gaggtccggccgctcgaaagcggctgggcgcgcgggctcacgatcgcggtgctgttcatc
gcgtggggcgcgcgtgtcgcatggcgcagctggcgcgcgggccgcctcaacgcgcagttg
ctgaaccagctgcgcgaggccgctcccgggccggccaccgccgacgatccggcaaaggcg
cagctcgacgagttgcgcagccgcttcgacgaggccgcttcgctgctgaagaaggtgcgc
ttcggacaggccgacaccgtgcgcaagggcctgccgcgctggttcgaccggatgtcgcgc
cagtatctgtatcagctgccttggtacgtgttcatcggcgcgccgggctcgggcaagacc
accgcgctcgtgaattccgggctcagctttccgctcgcggagcagttcggccgcgcggcg
attcgcggcgtgggcggcacgcggcattgcgactggtggttcacgaacgacgcggtgctg
atcgacaccgccggccgttacacgacgcacgagggcaatcgcgcgctcgacgaggccgag
tggaaaggcttcgtcgacctgctgaagaaataccgcacgcgccagccgctgaacggcgcg
atgctgacgatcagcgtcgccgacctgctcggcgcgtcggaggccgaacgcacgcagcac
gcgatggtgctgcgcaagcggctgctcgaactgcgcgcgcagctcggcattcgctttccc
gtgtacctgctcgtgacgaaggccgacctgctggcgggcttcgccgagtatttcagcagc
tacggccgcaccgaatgcgcgcaggtgtggggctttacgttcccgctcgcgcagagcgag
gcgccgggtttcgacctgcgcgcggcgttcgaccgtgaataccggctgctgcaccagcgg
ctgaacgacggactgcccgaactgctcgccgcgcagaccgacgcgcgccagcgcgaaatg
acgtacctgctgccgcagcagatcgccgacctgcaggacatgctcggccagttcgtcgcc
gaggtgttttcggtgtcgagctacgagccgatgccgatgctgcgcggcgtctacctgacg
agcggcacgcaggagggcaccgcgttcgatcgcgtgatgagcggcatcaagcgtttcctg
aagatcgagggcgtgccgccggtcgcgcaggtcggctcgaccgggcgcagcttcttcctg
aagtcgctgctgcaggaacacatcttccgcgaagccgcgctcgccggcagcgacctgcgc
tggcatcagaagcggcgcgtgctacagatcgtcggctacgtgctgctcgcgctggtgtgc
gtggccgtgctggtcgcgtggctgcgcagctattcgaacaatcgcgcgtatctcgaccag
atcgccgcgcgcgtgccggccgtcgatgcgcagatcgccggcgcgaaattctccgatgcg
gccgacgtcgcccgcctgttgcccgtgctcgacgcgctcggcaacctcgcgaatgcgggc
ggcgtcgacctgcagcatccgccgcttgcgtatcggtgggggctgttccagggcgagaag
atcgacgaagccgtcgacgccgtgtaccggcgcgcgctcgaagacgtgctgctgccgatc
gccgcgcgccggatggaggccgcgctgcgcgacgcacggcccgacgagaccgaatacgcg
tatgcggcgctgaaggcgtacctgatgctgtacgacagcgcgcactacgatcccgcgttc
gtgcaggccgtcgtcgatctcgaaatggaacgcgcgctgccgcccgatttctcgccggcc
gaacgcaccgcgctgcgtgcgcatctcgccgcgctgttcggcaaccgtgtcgcggtgtcg
ccgtatccgatgaacgagcggctcgtggccgacgtgcgcgaccgcttgcggcaggtgccg
ttctcgcagcggctgtaccggcagctcacgctcacgctgcggccggccacgtccgcgttc
gacttcagcgtcgcgcgggcggtcggccccgatgcttcactggtgttccgccgccagagc
ggcaagccgctgtcggaaggcgtgccggggctctatacgcgcaacggctatcgcaatgtg
ttcgcgccgcgcctggccggcgaggtcgacacctacgggcgcgaggaagtgtgggtgctg
aacctcgggttgtccgagattccgggcccgaacgacgctgccgcgtgggcgcgcgatatc
cgccagctctacctgaacgactacctgaagatctgggacgactatctcgccgacatcaag
ctgcagcgcacggcgacgctcgcgcagagcatccaggtggcgcgcgcgctgtcgtccgcc
gattcgccgctcacgcggctgatggtcgcgctcgcacgcgataccgcgctcggcgatgca
ccgggcggggcgcgcaatctcgccgcgcgcgcgcaggacaaggtcgacgaggcgcgcagc
tcgctgtcgcagatcttcgcgggccagggcagcgattcgagcgcgtccgcggcggcgccc
gcgagcgccgagcagatcgtcgacagccacttcgccgggctgcgcgcgttcgcgccgggc
agcggcgaccaggcccaggcgttcagcgaggtgctgaagtcgatcgacgcgctgtacacg
tacctgacggccaccgacgacgccttgagaagcggcgcgcaaccgccgccgtccgacgcg
ccagccaggctgcgcgcacaggccggccgcctgccgacaccattccgcgaagtgctcgac
gacctgtctaacgtcgcgaacggcagcgtcgcgactgtcgagcagcgcagcgtcgcgacg
cgggccggtgcgaacgtcggtgacttctgccggcaggcgatcgcgggccgctatccgttc
gcgcgtggctcgtcacgcgacgtcgcgccggcggatttcgcgcagatgttcgcgcccggc
ggcctgatggacgacttcttccagaagaacctgcagtcgatcgtcgatacgacgtcgcac
ccgtggcgcttcgcgaaccgcaatgcggacgccgatccgtcggccgccgcgatgcttgct
tcgttcgagaaggcggcggtgatccgcgacgcctatttcggcggcggcgcacgcaccgcg
cagttgaaggtacagatccagccgctcgaaatggacccgtcgatcacggagatggtgctc
gacgtcgacgggcagatcgtccgctacgcgcacggcccgctcgtgcagagtgcggtggac
tggccgggcccgcgcggcagcaaccaggtgcggctgcaggtgtccgggcaggccggcgcg
accgacggcttctcgaccgacgggccgtgggcgctgcaccggttgttcgaccgcgcggcc
gtgtcggccggacgcggctcggaccagatgattgcgcggttcacggtcgacggcaaaccg
atcgtgctgcaagtgaatgcgggcagtgtccgcaacccgttcaggctgccccagatggag
tcctttacatgccctccgaagccatga

DBGET integrated database retrieval system