KEGG   Burkholderia lata: Bcep18194_B1593
Entry
Bcep18194_B1593   CDS       T00286                                 

Definition
(GenBank) outer membrane protein, OmpA/MotB family
  KO
K11892  type VI secretion system protein ImpK
Organism
bur  Burkholderia lata
Pathway
bur03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bur00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcep18194_B1593
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bur02044]
    Bcep18194_B1593
Secretion system [BR:bur02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep18194_B1593
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: ABB11707
UniProt: Q396A4
Position
2:complement(1813216..1814538)
AA seq 440 aa
MNSSSDSISPGTGGFVPPNPGGMHPAAAGAAGPTATQPRPGRWAASGTNPLVAAANPLLN
LVPQIRSTVHHPNPAWLREHLVVEIRQFEARAQEAGVPSEAIIGARYCLCTALDEAAALT
PWGGSVWSSHSLLVSFHNETWGGEKFFHLLERLSQQPRQHLDLLELLYFCLALGFEGRYR
VLDNGHAQLDALRHQLALTIRSVRGEFEPALSPHWRDVVTRDVARRFVVPLWVCVALALL
IGFGVFVGLRIALAGHSDRLFASIDALHVPKLQPAQAPPRPAPAPRIAKFLEPEIAAGLV
SVRDDADRSVIVLRGDGLFKSGSTSVIDRYVPVLARVADALNKVPGNVRVTGYTDDTPVH
TARFASNWDLSRERAEAVRGMIAARLDHPERLAAEGRGTLDPVAPNDSPANRALNRRVEI
TLLPAPGSAAVGASATQGAN
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgaattcctcctccgattcgatctcccccggcaccggcggattcgtgccgccgaatccg
ggcggcatgcatccggccgcggcgggcgcggccggcccgaccgcgacgcagccgcgcccc
gggcgctgggccgcgagcggaacgaacccgctcgtcgcggccgcgaatccgttgctcaac
ctggtgccgcagatccgctcgaccgtccatcacccgaatccggcgtggctgcgcgagcat
ctggtcgtcgagatccggcagttcgaggcccgtgcgcaggaagccggcgtgccgtcggaa
gcgatcatcggcgcgcgctactgcctgtgcacggcgctcgacgaggccgccgcgttgaca
ccgtggggcggcagcgtctggtcgtcgcacagcctgctcgtgtcgttccacaacgaaacg
tggggcggcgagaaattcttccacctgctcgaacgcctgtcgcagcagccgcgccagcat
ctcgacctgctcgagctgctgtatttctgtctcgcgctcggcttcgagggccgctatcgg
gtgctcgacaacggccatgcgcagctcgacgcgctgcgccaccagctcgcgctgacgatc
cgctcggtgcgcggcgaattcgagccggcgctgtcgccgcactggcgcgacgtcgtcacg
cgcgatgtcgcgcgccggttcgtcgtgccgctgtgggtctgcgtggcgctcgcgctgctg
atcggcttcggcgtgttcgtcgggctgcgcattgcgctcgccgggcattcggatcggctg
ttcgcgtcgatcgacgcgctgcacgtgccgaagctgcaacccgcacaggcgccaccgcgc
ccggcaccggcgccgcgcatcgcgaagttcctggaaccggagatcgcggccggcctcgta
tcggtgcgcgacgacgccgatcggagcgtgatcgtgctgcgcggcgacgggttgttcaag
tccggctcgacgtcggtgatcgaccgctacgtgccggtgctcgcgcgggtggccgacgca
ctgaacaaggtgcccggcaacgtgcgggtgaccggctataccgacgacacgcccgtgcat
acggcgcgcttcgcgtcgaactgggacctgtcgcgcgaacgcgcggaagccgtgcgcggg
atgatcgccgcgcggctcgaccatccggaacggctcgcggcggaagggcgcggcacgctc
gacccggtcgcaccgaacgattcgccggcgaaccgcgcgctgaaccggcgcgtcgagatc
acgctgctgccggcgcccggcagtgccgccgtcggcgcgagcgccacgcagggagccaac
tga

DBGET integrated database retrieval system