KEGG   Burkholderia lata: Bcep18194_B1595
Entry
Bcep18194_B1595   CDS       T00286                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
bur  Burkholderia lata
Pathway
bur03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bur00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcep18194_B1595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bur02044]
    Bcep18194_B1595
Secretion system [BR:bur02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep18194_B1595
SSDB
Motif
Pfam: T6SS-SciN DUF4893
Other DBs
NCBI-ProteinID: ABB11709
UniProt: Q396A2
Position
2:complement(1815969..1816484)
AA seq 171 aa
MQWRSSSFIVWGCVMLLPGCGATEHAAAVPYAITVDVAPDVNPDMNRKPSPIVLKVFQLR
AASSFDSADFFSLQDKPENVLGADLLGTDRVILRPGESRTLHYRGNVEAGAIGVVAEYRM
LEKNRWRLTVPLPRAKQLNLYKFWQTSPGELKLSIAVRNGGIALNDAKGRP
NT seq 516 nt   +upstreamnt  +downstreamnt
atgcaatggcggtcgagcagtttcatcgtatggggatgcgtgatgctgttgccggggtgc
ggtgcgacggagcacgccgcggcggtgccgtatgcgatcacggttgacgtcgcgcccgac
gtcaacccggacatgaaccgcaagccttcgccgatcgtgctgaaggtgttccagctccgc
gcggcgtcgtcgttcgacagcgcggacttcttctcgctgcaggacaagccggaaaacgtg
ctcggcgcggacctgctgggcaccgaccgcgtgatcctgcggccgggcgagtcgcgcacg
ctgcactatcgcggcaacgtcgaggccggcgcgatcggcgtggtcgccgaataccgcatg
ctcgaaaagaaccgctggcggctgacagtgccgctgccgcgcgcaaagcagctcaatctc
tacaagttctggcagacgtcgccgggcgaactgaagctgtcgatcgccgtacgcaatggc
ggcatcgcactgaacgatgcgaaggggcgcccatga

DBGET integrated database retrieval system