KEGG   Burkholderia lata: Bcep18194_B2377Help
Entry
Bcep18194_B2377   CDS       T00286                                 

Definition
(GenBank) amino acid ABC transporter membrane protein 1, PAAT family
  KO
K10016  histidine transport system permease protein
Organism
bur  Burkholderia lata
Pathway
bur02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bur00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bcep18194_B2377
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bur02000]
    Bcep18194_B2377
Transporters [BR:bur02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    Bcep18194_B2377
   Histidine transporter
    Bcep18194_B2377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABB12488
UniProt: Q392X8
Position
2:complement(2708391..2709122)
Genome map
AA seq 243 aa AA seqDB search
MAVENPATSFWIPHMIFQGFGPLLWAGTVETVKLAVLSLAASLVLGLIGASAKLSTNRML
KSIGTFYTTLIRAVPDLVLMLLLFYGIQILLNNVTDMLGWDQIDIDPFVAGVITLGFIYG
AYFTETFRGAFLAVPRGQLEAGFAYGMSGWRVFRRILFPQMMRFALPGIGNNWQVLVKAT
ALVSIIGLADVVKASQDAGKSTLDFFFFTLAAGAIYLAITTVSNVVLHHLEKRYSVGVRR
LAL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaaaatccagccacatcgttctggatccctcatatgatcttccaaggattt
ggcccgctgttgtgggccggcacggtggaaaccgtgaagctcgcggtgctgtcgctcgct
gcgtcgctcgtgctgggcctcatcggcgcaagcgcgaaactgtcgacgaaccgcatgctc
aagtcgatcggcaccttctacacgacgctgatccgcgcggtgccggacctcgtgctgatg
ctgctgctgttttacgggatccagatcctgctgaacaacgtcaccgacatgctcggctgg
gaccagatcgacatcgatccgttcgtggccggcgtcatcacgctcggcttcatctacggc
gcgtacttcaccgagacgttccgcggtgcgttcctcgcggtgccgcgcggccagctcgaa
gcgggcttcgcgtacgggatgagcggctggcgcgtgttccgccgcatcctgttcccgcag
atgatgcgcttcgcgctgcccggcatcggcaacaactggcaggtgctcgtgaaagccacc
gcgctcgtgtcgatcatcggcctcgccgatgtcgtgaaagcgtcgcaggacgcgggcaag
agcacgctcgatttcttcttcttcacgctggctgcaggcgcgatctacctcgcgatcacg
acggtctccaacgtcgtgctgcatcacctcgagaagcgttattccgtcggcgtccggagg
ctcgcactgtga

DBGET integrated database retrieval system