KEGG   Burkholderia lata: Bcep18194_B2954Help
Entry
Bcep18194_B2954   CDS       T00286                                 

Definition
(GenBank) Amidohydrolase 2
  KO
K22213  6-methylsalicylate decarboxylase [EC:4.1.1.52]
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bcep18194_B2954
Enzymes [BR:bur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.52  6-methylsalicylate decarboxylase
     Bcep18194_B2954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: ABB13065
UniProt: Q390Q1
Position
2:3340067..3341017
Genome map
AA seq 316 aa AA seqDB search
MSDRNRIDVHQHVVPPFWADALPAHGGDPSGWGSPTWSPESAIAFMDSLEIQTGVLSLTA
PGVQGWNGQAKRDMARQVNEYVAGLVAKLPTRFGNFATLPLPDVDGTLAEIGHAFDTLKA
DGVVLLSNYGGTYLGDAAFEPVWDELDRRRAVVFIHPAKPAIDAIPGMPGPLLDYPFDTT
RTAVQLVLNGVIARHPNVRIILSHAGGFLPYTAYRFAELAPGVRNDVPNRDGLLDLLRTF
YFDTALSSPSALPSLTAFAQPDRVLYGSDFPYAPPAVSTSFTHAQDAYAALGADRHAAIN
HTNALPLFPRLAALAR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccgcaaccgtatcgatgtccaccaacacgtcgtcccaccgttctgggccgac
gccctgcccgcccacggcggcgacccgtccggctggggcagccccacctggagcccggaa
agcgcgatcgcgttcatggattcgctggaaatccagaccggcgtgctgtcgctgacggcg
cccggcgtgcagggctggaacggccaggccaagcgcgacatggcgcgccaggtcaacgaa
tacgtggccggcctcgtcgcgaagttgccgacccgcttcggcaacttcgcgacgctgccg
ctgcccgacgtcgacggcacgctcgccgaaatcggccacgcgttcgacacgctgaaggcc
gacggcgtcgtgctgctcagcaactacggcggcacgtatctcggcgatgcggcgttcgaa
cccgtgtgggatgaactcgaccgccgccgcgcggtcgtgttcatccacccggcgaagccg
gcgatcgatgcgatacccgggatgcccggcccgctgctcgactatccgttcgatacgacg
cgcacggccgtccagctcgtgctcaacggcgtgatcgcgcggcacccgaacgtgcgcatc
atcctgtcgcacgcgggcggcttcctgccgtacaccgcgtaccgctttgccgaactcgcg
ccgggcgtgcgcaacgacgtgccgaatcgcgacgggctgctcgacctgctgcgcacgttc
tacttcgataccgcactgtcgtcgccgtcggcgctgccgagcctcaccgcgttcgcgcaa
cccgatcgcgtgctgtacggcagcgacttcccgtacgcgccgcccgccgtcagcacgtcg
ttcacccacgcgcaggatgcgtatgcggcgctgggcgccgaccggcacgcggcgatcaac
cacacgaacgcattgccgctgttcccgcgtctcgctgcactcgcgcggtaa

DBGET integrated database retrieval system