KEGG   Burkholderia lata: Bcep18194_C6773Help
Entry
Bcep18194_C6773   CDS       T00286                                 

Definition
(GenBank) Iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bur  Burkholderia lata
Pathway
bur00010  Glycolysis / Gluconeogenesis
bur00071  Fatty acid degradation
bur00350  Tyrosine metabolism
bur00625  Chloroalkane and chloroalkene degradation
bur00626  Naphthalene degradation
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur01120  Microbial metabolism in diverse environments
bur01130  Biosynthesis of antibiotics
bur01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep18194_C6773
  Lipid metabolism
   00071 Fatty acid degradation
    Bcep18194_C6773
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcep18194_C6773
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcep18194_C6773
   00626 Naphthalene degradation
    Bcep18194_C6773
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcep18194_C6773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 MitMem_reg
Motif
Other DBs
NCBI-ProteinID: ABB05820
UniProt: Q39NZ6
Position
3:295964..297130
Genome map
AA seq 388 aa AA seqDB search
MEMSPQSMLFETVPSILQEWGCVRRLGQVMAAWTERRHVLIVTDAGLHNAGVLEPAKASL
AAEGFRVAVFDEVVADPPESVVSRCVEFARGAEADIVIGLGGGSSMDIAKLAAVLTVSRQ
SLAEMYGIGNVKGARLPLVQIPTTAGTGSEVTNISIVSVNETTKMGIVSRQLYADKVILD
AELTVGLPRSHTAATGIDAMVHAIEAYTSKHKKNALSDALAREALRLLVSNLIPACENGH
DRHAREAMLLGATLAGQAFANAPVAAVHALAYPLGGHFHIPHGLSNALMLGPVLRFNAEA
AASHYSELADVVSVGGTGDATARTAAFIAFLEDLMDRSGAPRRLRDVGVTQASLPTLAAD
AMKQQRLLLNNPVVVTESDALRLYEQAY
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgtccccgcaatcgatgctcttcgaaactgttccgtccattctccaggaatgg
gggtgtgtacgccgcttgggtcaggtgatggcggcctggacggagcgccgtcatgtcctg
atcgtgaccgacgcggggctgcacaacgccggtgtgctggaaccggcgaaagcgtcgttg
gcagccgagggattccgtgtggcggtttttgatgaggtcgtggccgacccgccggagagc
gtggtctcgcgctgcgtcgagttcgcgcgcggtgcggaggcggatatcgtcatcggcctg
ggcggcggctcgtcgatggacattgcaaaactggccgccgtgctcaccgtctcgcggcaa
tcgctcgcggaaatgtacggaatcggcaacgtgaagggcgcacggctgccattggtgcag
atccctacgacggccggtaccggatcggaagtcaccaacatttccatcgtttcggttaac
gaaacaaccaagatgggcatcgtctcacgtcagctgtatgccgacaaagtgatcctggac
gccgaattgacggtcggtctgccgcgcagccataccgccgcgacgggcatcgacgcgatg
gtccacgccatcgaggcctataccagcaagcacaagaagaatgccctctccgacgcgctt
gcgcgtgaggctctgcgattgctggtgagcaacctgatcccggcttgcgaaaacggtcac
gaccggcatgcacgcgaggcaatgctgctgggcgccacgctggcggggcaggccttcgcc
aatgccccggtggccgcggtccatgcgctcgcgtatccgttggggggccatttccatatc
ccgcatggcttgtccaacgcattgatgcttggccccgtgctgcgattcaacgccgaagcg
gccgcttcgcattattcggaactggcagacgtcgtaagcgtgggtggaacgggcgacgcc
acggcgcgcacggcggcgttcatcgcattcctggaagacctgatggaccgatccggcgcg
ccgcgacgtctgcgcgacgtgggtgtcacgcaggcgagcctgccgaccctggcggccgat
gcgatgaagcagcagcgcctgctgttgaacaatccggtcgttgtcacggagtcggacgca
ttgcgcctgtatgaacaggcctattga

DBGET integrated database retrieval system