KEGG   Burkholderia lata: Bcep18194_C6854Help
Entry
Bcep18194_C6854   CDS       T00286                                 

Definition
(GenBank) Secretion protein HlyD family
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl_2 HlyD_D23 HlyD_3 HlyD PTS_EIIA_1 LZ_Tnp_IS66
Motif
Other DBs
NCBI-ProteinID: ABB05900
UniProt: Q39NR6
Position
3:complement(397253..398167)
Genome map
AA seq 304 aa AA seqDB search
MSLKPLTRSLLTLATVAVAIVLVAALWHAYVLAPWTRDARVSAHVVRIAPEVSGTVVDVA
VVDNQRVAKGDVLYRIDPQRFTLAVEQAEAQVAATAESMRQKRDEAQRRTGLDDLVPRED
IQRSSRAVSIAQAEHRKALAALDVAKLDLERTTLRSPVDGYVTQLRLRHGDYAVEGKPGI
SVLDAHSFWITGYFEETKLRRIATGAPATIRLMGFDPLLSGHVTSIGRGIADENGTLDEL
GLPAVNPTFSWVRLAQRIPVRIEIDQVPAGVLLAAGMTCSVEVGERGHERTPRGRLASWL
HAWM
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcaaacccctcacccgctccctgctgacgctcgccacggtggccgtcgcgatc
gtgctggtcgccgcgctctggcatgcgtatgtcctcgcgccgtggacccgtgacgcgcgc
gtcagcgcgcacgtcgtgcggatcgcgcccgaagtgtcgggcaccgtcgtcgacgtcgcg
gtggtcgacaaccagcgcgtcgcgaaaggcgacgtgctgtaccgaatcgatccgcagcgc
ttcacgctggcggtggaacaggcggaagcgcaggtcgccgcgaccgccgagtcgatgcgc
cagaagcgcgacgaagcgcagcggcgcaccggtctcgacgatctcgtgccgcgcgaggac
atccagcgctcgagccgcgcggtgtcgatcgcgcaggccgagcaccgcaaggcactggcc
gcgctcgacgtcgcgaagctcgacctcgaacgcacgacgctgcgctcgccggtcgacggc
tacgtgacgcagctgcgcctgcgtcacggcgactacgcggtcgaaggcaagcccgggatc
tcggtgctcgacgcgcacagcttctggatcaccggctatttcgaggaaaccaagctgcgc
cgcatcgcgacgggtgcgcccgcaacgatccggctgatgggcttcgatccgctgctgagc
gggcacgtgacgagcatcggccgcggcatcgcggacgagaacggcacgctcgacgagctc
ggcctgccggccgtcaacccgaccttcagctgggtgcggctcgcgcagcgcattccggtc
cgcatcgaaatcgaccaggtgccggctggcgtgctgctggcggctggcatgacgtgcagc
gtcgaagtcggcgaacgcgggcatgagcgcacgccgcgcgggcggctcgcgtcgtggctg
cacgcgtggatgtga

DBGET integrated database retrieval system