KEGG   Burkholderia lata: Bcep18194_C6857Help
Entry
Bcep18194_C6857   CDS       T00286                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_30 HTH_29
Motif
Other DBs
NCBI-ProteinID: ABB05903
UniProt: Q39NR3
Position
3:complement(400579..401502)
Genome map
AA seq 307 aa AA seqDB search
MAPDLNLLISLDALLEEGSVVGAARRMNLSPPAMSRTLARIRETVGDPIFVQAGRKMVPT
PRALELRGVVRETVERASQLLAPSAEIDLGTLDKQFNVRANDIFVGLHSSRLLEEMARGM
PRAMLRFMPEEDDIDDDALRSGRIDLFISASRRLGPEIRVQPLFTTTFVGLARDDHPIFD
DDITPERFARWPHIGVSRRGKSAGPIDDALAARGLARHVLLVVPTPYAAIFALQASDLIL
PLPEHLARGAVRAGLGVRAFELPVPLETVLITQAWHPRFQSDPAHQWLRRVVRGLCTGQP
ALHPAHA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcacccgacctgaacctgctgatttcgctcgacgcgctgctcgaagagggtagcgtc
gtcggcgccgcacgccgcatgaacctcagcccgcccgcgatgagccgcacgctcgcgcgc
atccgcgaaacggtcggcgacccgatcttcgtgcaggccggccgcaagatggtgccgacg
ccgcgcgcgctcgaactgcgcggcgtcgtccgcgagaccgtggagcgcgcgtcgcagttg
ctcgcgccttccgcggaaatcgatctcggcacgctcgacaagcagttcaacgtgcgcgcg
aacgacatcttcgtcggcctgcacagcagccgcctgctcgaggagatggcgcgcgggatg
ccgcgcgcgatgctgcgcttcatgcccgaggaagacgacatcgacgacgacgcgttgcgc
agcggccgcatcgacctgttcatcagcgcatcgcgccgcctggggccggagattcgcgtg
cagccgctgttcacgacgaccttcgtcggcctcgcgcgcgacgaccacccgatcttcgac
gacgacatcacgcccgagcgcttcgcgcgctggccgcacatcggcgtgtcgcggcgcggc
aagtcggcggggccgatcgacgacgcgctcgccgcgcgcgggctcgcgcggcacgtgctg
ctcgtcgtgccgacgccgtatgcggcgatcttcgcgctgcaggcgtcggacctgatcctg
ccattgcccgagcatctcgcgcgcggcgcggtgcgggccgggctcggcgtgcgcgcgttc
gaactgccggtgccgctcgaaaccgtgctgatcacgcaggcgtggcatccgcgcttccag
agcgaccccgcgcaccagtggttgcggcgtgtcgtgcgcgggctgtgcaccggccagccg
gcgctgcatccggcgcacgcatga

DBGET integrated database retrieval system