KEGG   Burkholderia lata: Bcep18194_C6858Help
Entry
Bcep18194_C6858   CDS       T00286                                 

Definition
(GenBank) Flavin reductase-like, FMN-binding protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavin_Reduct
Motif
Other DBs
NCBI-ProteinID: ABB05904
UniProt: Q39NR2
Position
3:complement(401626..402153)
Genome map
AA seq 175 aa AA seqDB search
MMNTVDIAQQLKQAMRGVAATVTIVTTGGDGAAAAPCALTASSFTSVALDPPTVLVCINR
RASIHASITGHRRFCVNALRSCHVPLALACSTTGSDARFAHDAWRTDAATGLPYLENAQT
SFFCDTLEQVEVGSHSILVGRVTRVAMSDDVNPLMYVNGAFAAVRSLPPDAGAGQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaccgtggacattgcgcagcaactgaaacaggcgatgcgcggcgtagccgcc
accgtcacgatcgtcacgaccggtggcgacggcgccgcagccgcaccgtgcgcgctgacc
gccagctcgttcacgtcggtcgcgctcgatccgccgaccgtgctggtgtgcatcaaccgg
cgcgccagcattcacgcgtcgatcaccggccaccggcgcttctgcgtgaacgcgctgcga
agctgccacgtgccgctcgcgctcgcgtgcagcacgacgggctccgatgcgcgtttcgcg
cacgacgcatggcgcaccgacgcggccaccggcctgccgtacctcgagaacgcgcagacg
tcgttcttctgcgacacgctcgaacaggtcgaggtcggctcgcattcgatcctggtcgga
cgggtcacgcgcgtcgcgatgtccgacgacgtgaacccgctgatgtacgtgaacggcgcg
ttcgccgccgtccgctcgctgccgcccgatgccggcgccggccaatga

DBGET integrated database retrieval system