KEGG   Burkholderia lata: Bcep18194_C6859Help
Entry
Bcep18194_C6859   CDS       T00286                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00480  salicylate hydroxylase [EC:1.14.13.1]
Organism
bur  Burkholderia lata
Pathway
bur00621  Dioxin degradation
bur00624  Polycyclic aromatic hydrocarbon degradation
bur00626  Naphthalene degradation
bur01100  Metabolic pathways
bur01120  Microbial metabolism in diverse environments
bur01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    Bcep18194_C6859
   00626 Naphthalene degradation
    Bcep18194_C6859
   00624 Polycyclic aromatic hydrocarbon degradation
    Bcep18194_C6859
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.1  salicylate 1-monooxygenase
     Bcep18194_C6859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 FAD_binding_2 NAD_binding_8 Pyr_redox_2 Trp_halogenase DAO Pyr_redox FAD_oxidored SE HI0933_like GIDA Thi4 Amino_oxidase Pyr_redox_3 AlaDh_PNT_C ApbA
Motif
Other DBs
NCBI-ProteinID: ABB05905
UniProt: Q39NR1
Position
3:complement(402220..403482)
Genome map
AA seq 420 aa AA seqDB search
MPIPSGPTANPPMTPSLSLDTIVVGAGIGGLAAALALRRAGHRVTVLEQSRAFREVGAGL
QVVPNATRALRALGVLDRQRLAAVAPTATIRRRWQDGSLLGSFPLGNEVEAAFNAPYWNA
HRADLHAALLDAVRDPYTAGPPVAVLGGIAVRGLDACGPDGATLVDAAGTRWRADLVVAA
DGIHSTLRHALLGDDAPHYSGDDAYRALIDVDAIDPQSPVFEIVKEPQVTIWLGPGRHAI
HYWVRDRRLLNLVVIVPGDGSTRESWSSKGDRATLEAELDGWDPRLVGLIRCASDLSRWS
LHDRQPLTRWVWDSVCLLGDACHPMLPYQSQGAAQALEDAVVLGRCVTGLASKEALGAAL
VEYQRLRIDRSARIQLASAGNGGVFHLPDGPEQQARDAELKSRRADFKSYHWTWADAYQL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcccttccggacccacagcgaacccgcccatgacaccttccctgtcactcgac
acgatcgtcgtcggcgccgggatcggcggcctggccgccgcgctcgcgctgcgccgcgcc
ggccatcgcgtcacggtcctcgagcaaagccgggcgttccgggaagtcggcgcggggctg
caggtcgtgccgaacgccacgcgcgcgctgcgcgcgctcggcgtgctcgaccggcagcgg
ctggccgccgtcgccccgaccgcgacgatccgccgccgctggcaggacggcagcctgctc
ggctccttcccgctcggcaacgaggttgaagccgccttcaacgcaccgtactggaacgcg
catcgcgccgacctgcatgccgcgctgctcgacgccgtgcgcgacccgtacacggcgggc
ccgccggtcgccgtgctcggcggcatcgcggtgcgcgggctcgatgcatgcgggccggac
ggcgcgacgctcgtcgatgcggcgggcacgcgctggcgcgcggatctggtcgtcgcggcc
gacggcattcattcgacgctgcgccacgcgctgctcggcgacgacgcaccgcactacagc
ggcgacgacgcgtatcgcgcgctgatcgacgtcgacgcgatcgatccgcaatcgcccgtg
ttcgagatcgtcaaggaaccgcaggtgacgatctggctcgggcccggtcggcacgcgatc
cattactgggtgcgcgatcgccggctgctgaacctcgtcgtgatcgtgccgggcgacggc
agcacgcgcgaatcgtggagcagcaagggggatcgcgcgacgctcgaggccgagctcgac
ggctgggatccgcgcctcgtcgggctgatccgctgcgcgtcggacctgagccgctggtcg
ctgcacgaccgccagccgctcacgcgctgggtgtgggacagcgtgtgcctgctcggcgac
gcgtgccatccgatgctgccgtaccagtcgcagggcgccgcgcaggcgctcgaggacgcg
gtcgtgctcggccggtgcgtgacggggctcgcgtcgaaggaagccctcggcgccgcgctg
gtcgagtaccagcgcttgcggatcgaccgcagcgcacggatccagcttgcgtcggccggc
aacggcggcgtgttccacctgcccgacggccccgagcaacaggcgcgcgacgccgagctc
aagtcgcgccgcgccgacttcaagtcctaccactggacctgggccgacgcgtaccagctt
tga

DBGET integrated database retrieval system