KEGG   Burkholderia lata: Bcep18194_C6866Help
Entry
Bcep18194_C6866   CDS       T00286                                 

Definition
(GenBank) TonB-dependent siderophore receptor
  KO
K02014  iron complex outermembrane recepter protein
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bur02000]
    Bcep18194_C6866
Transporters [BR:bur02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bcep18194_C6866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec Plug
Motif
Other DBs
NCBI-ProteinID: ABB05912
UniProt: Q39NQ4
Position
3:410021..412267
Genome map
AA seq 748 aa AA seqDB search
MNRSHTGRRARPGFPLPRAALRRVPSWAAALACATAMPVAVAAQDAPDAGEPAADASLLA
PIVVDGRRETGVGPVQGIAADVSRAGTKTDTAIVEVPQGLSVVTREQMDRQDVHSVGDSL
RYTPGAYADSRPGGVLESVFLRGFGGFAAAAINPQMLDGLPLPKGVNWAASVVDPWTLER
IDVLRGPASVLYGQASPGGIVDMVSKRPTRDAQHLLAVQTGNRDRGQLAFDFSGPVTKDG
TWRYRIDGLARRADEQIDYSRQQRIVVAPSLTWQPNADTSFTLLGSFQRDPHNNFAGWLP
ALGTLWPDSGRRIPTHFFPGLPGFDTYDRTQAMIGYAFEHRFNSTWKVRQNVRYTHLDVD
FAGAAVNFIAPYLSPGVLNRSLSWSREHVNHLALDNQAEMRVMTGPVEHTVLAGLSYEHA
VANLVGSGFGAAPPLDTRAPAYGQPFTVPPVAQQTRQTPDRIGVYLQDQVRWDRWVFTLG
GREEWSRTTTDDLLRSASVRQSTRAFTGRAGAVYLFDSGFAPYMSYSTSFEPALGTRFDG
QPFTPTKAKQFEVGLRYQSLDRLQNASIAAFDIRQRNVLTADPEHPFFSVQTGEVRSRGI
ELEGRTRVWKQLDVIAAYTYLDTTVQADTDPTVVGKRVAAVPRHLASLWLDYAVERPGLR
GLRVGGGVRYVGRSAGDNVNTFDVPAVVLFDLGLSYDLGVERPAWKGWRVAAHVNNLFDR
TYVSSCFSAGGCFYGTRLMVTGDVSYRW
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgatcacacaccggccgccgtgcgcggccaggatttccgttgccgcgcgcggcg
ttgcggcgcgtgccgagctgggcggccgcactggcctgtgcgaccgcgatgccggttgct
gttgcggcgcaggatgcgccggacgcgggcgagcccgcggcggatgcgtcgctgctcgcg
ccgatcgtcgtcgatgggcgacgcgagacgggtgtcggccccgtacaaggcatcgcggcc
gacgtgtcgcgcgcgggcaccaagaccgacacggcgatcgtcgaggtgccgcagggcctg
tcagtcgtcacgcgcgaacagatggaccggcaggacgtgcacagcgtcggcgacagcctg
cgctacacgcccggtgcctacgcggactcgcgccccggcggcgtgctcgagagcgtgttc
ctgcgtggcttcggcggctttgcggcagcggcgatcaatccgcagatgctcgacggcctg
ccgttgccgaaaggcgtgaactgggccgcgagcgtcgtcgatccgtggacgctcgaacgc
atcgacgtgttgcgcggcccggcgtcggtgctgtacgggcaggcgagccccggcggcatc
gtcgacatggtcagcaagcggccgacgcgcgatgcgcagcacctgctcgccgtgcagacc
ggcaaccgcgatcgcgggcagcttgcgttcgatttcagcggaccggtgacgaaggacggc
acgtggcgctaccggatcgacggtctcgcgcgccgcgcggacgagcagatcgattattcg
cggcagcagcggatcgtcgtcgcgccgtcgctgacgtggcagccgaatgccgatacgagt
ttcacgctgctgggttcgttccagcgcgatccgcacaacaacttcgcgggctggctgccg
gccctcggtacgctttggccggattcgggacggcggattccgacgcacttctttccgggg
ctgcctggattcgatacgtacgaccgcacgcaggcaatgatcggctacgcgttcgagcat
cgtttcaactcgacgtggaaggtccggcagaacgtgcgctatacgcacctcgatgtcgac
ttcgccggcgcggccgtgaatttcatcgcgccttatctgtcgccgggcgtgctgaaccgt
tcgttgtcctggtcgcgtgagcacgtgaaccatctcgcgctcgacaaccaggccgagatg
cgcgtgatgacagggccggtcgagcatacggtgctggccggcctgtcgtatgagcatgcg
gtggcgaatctcgtcgggtcgggcttcggcgcggcgccgccgctcgatacgcgtgcgccc
gcttacgggcagccgtttaccgtgccgccggtcgcgcagcagacgcgccagacgcctgac
cggatcggcgtctatctgcaggatcaggtgcgttgggaccggtgggtctttacgctcggc
ggtcgtgaggagtggtcgcgcacgacgaccgatgacctgctgcggtccgcgagtgtgcgg
cagagtacgcgagcgttcacggggcgcgcgggggcggtttatctgttcgatagcggcttc
gcgccgtacatgagctattcgacctcattcgagccggcgctcggcacgcgcttcgatggt
cagccgttcacgccgacgaaggcgaagcagttcgaggtcggtctgcgctatcagtcgctg
gatcggctgcagaacgcgtcgatcgcggcgttcgatattcgccagcgcaatgtgttgact
gccgatccggagcatccgtttttcagcgtgcagaccggggaggtgcgatcacgcgggatc
gagctggaagggcgtacgcgcgtgtggaagcaactggatgtgattgctgcctacacgtat
ctcgatacgacggtgcaggccgatacggatccgaccgtcgtcggcaagcgcgtggcggcg
gtgccgcgccatctcgcgtcgctgtggctggactatgcggttgagcggccggggttgcgc
gggttgagggtgggtggtggtgtgcgttatgtcgggcgcagcgcgggcgacaacgtcaat
acgttcgatgtgccggctgtcgtgctgttcgacctcgggctgtcgtatgaccttggcgtt
gaacggcccgcgtggaaggggtggcgcgtggcggcgcacgtgaacaacctgttcgaccgg
acttatgtgtcgtcgtgtttttcggcgggggggtgtttctatggcacgcggttgatggtg
acgggggatgtcagttaccggtggtga

DBGET integrated database retrieval system