KEGG   Burkholderia lata: Bcep18194_C6867Help
Entry
Bcep18194_C6867   CDS       T00286                                 

Definition
(GenBank) Dipeptidyl aminopeptidase/acylaminoacyl-peptidase
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S9 Abhydrolase_6 Peptidase_S15 Hydrolase_4 DLH AXE1 DUF2920 Abhydrolase_1 Abhydrolase_3 Esterase BAAT_C Abhydrolase_2 LIP CHASE2 Abhydrolase_9
Motif
Other DBs
NCBI-ProteinID: ABB05913
UniProt: Q39NQ3
Position
3:412415..413329
Genome map
AA seq 304 aa AA seqDB search
MSIVVRRKQIAILLCRVLISGALIASVVGCAATAVGDTSIAPDLHETVVKVPVDEGASTR
DIVATTYMPDGPGPFPLIVLSHGSPPDPRDRPKVRRYRALPQIRTFVQLGFAVIVPIRRG
YGATGGVDEEDAGSCRHPDYLAAGQQAARDVLAAVRYAQTLPQVDRNRIVLVGQSAGGFA
SLAAASYAPQGVVAVVNFSGGRGGNPTTHPGMPCDPKQMADTIGHFASTTRVPVLWHYVQ
NDKYFAPEVVATWFAAFQGAGGRGQMIVEPAFGSNGHGMFSVKEAIPIWLPHFEAFVGPL
VAMK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgtcgttcgtcgaaagcagatagccatcctcttgtgccgggtgttgatctcg
ggcgcgttgatcgcttccgtcgtcggctgcgcggcgacggcggtcggcgacacgtccatc
gcgccggatctgcatgaaaccgtcgtcaaggtcccggtcgacgaaggggcgagcacacgc
gacatcgttgccactacctacatgccggacggccccgggccctttccattgatcgtgctg
agccacggcagcccgcccgatccgcgcgaccggccgaaggtgcgccgctaccgcgcattg
ccgcagatccggacgttcgtgcaactcggtttcgcggtcatcgtgccgattcgccgcggg
tacggggcgacgggcggggtcgatgaagaggatgcgggttcgtgccggcatcccgattac
ctcgctgcgggccagcaggccgcgcgcgatgtgctcgcggccgtgcggtatgcgcagacg
ttgccgcaggtggatcgaaaccgcattgtgctggtcgggcaatcggcgggtgggtttgct
tcgctggcggcggcgagctatgcgccgcagggggtggttgcggtggtgaacttctcgggt
gggcgtggggggaacccgacgactcatcccggcatgccgtgcgatccgaagcagatggcc
gacacgatcgggcatttcgcgagtacgacgcgcgtgccggtgctctggcattacgtgcag
aacgacaagtatttcgcgccggaggtggtggcgacgtggtttgccgcgtttcagggggcg
ggtgggcgcgggcagatgattgttgagccggcgtttggcagcaacggccacgggatgttc
tcggtcaaggaggcgataccgatctggttgccgcacttcgaggcgtttgtcgggccgttg
gtggcgatgaagtag

DBGET integrated database retrieval system