KEGG   Burkholderia lata: Bcep18194_C6868Help
Entry
Bcep18194_C6868   CDS       T00286                                 

Definition
(GenBank) Alpha/beta hydrolase
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr
Motif
Other DBs
NCBI-ProteinID: ABB05914
UniProt: Q39NQ2
Position
3:complement(414380..415318)
Genome map
AA seq 312 aa AA seqDB search
MKSLGLWLRRAGAALAFLLAFQAQSYAAAPVVTEHSLTVNGIGLHYLEAGAGNGTPIVLL
AGYGETSHMWLPLMPKLAVNHVVIAPDLPGAGASDIPAGGYDKKTMAQDIHALVKALGYR
DVEVVGHDIGLMVAYAYAAQYRDETRRLVLMESFLPGVGNWQSYYYSPAKWHFAFYGETP
LKLVQGRERIYLDHFWNDFAANPEHSVSEVDRALYTSIYAQPGRMRAGFEWFHAFPQDIQ
DFQQFARTPLQMPVLVLTGQKAAGRFTIDQARVAAVNVQGEVIEGVGHWLMSEAPDRTMG
ALVTFLNAGESR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcactcgggctttggctgcggcgcgcgggtgccgcgttggctttcctgttggct
tttcaggctcaatcgtatgcagcggcccccgtggtcacggaacattcgctgacggtcaac
ggtatcgggcttcactacctggaggcgggcgccgggaacggcacgcccatcgtactgttg
gccggctatggcgagacgagccacatgtggctgccgctcatgcccaagctggccgtgaat
cacgtcgtgatcgcaccggatctgccgggcgccggcgcgtcggacatcccggcgggcggc
tacgacaagaaaacgatggcccaggacattcacgcgctggtgaaggcgctcggctatcgc
gacgtcgaggtcgtgggacacgacatcggcctcatggtggcgtacgcgtacgccgcccag
tatcgggacgaaaccaggcgccttgtgctgatggagtcgttcctgccgggtgtcggaaac
tggcagtcatactattactcgcccgcgaagtggcatttcgcgttttatggcgaaacgccg
ctgaagctcgtgcaggggcgcgagcgaatttacctcgaccatttctggaacgactttgcg
gctaatcccgagcattcagtgtcggaggtggaccgcgcgctctatacaagcatctatgcg
cagccgggccgcatgcgtgcgggcttcgaatggttccacgcttttccgcaggatatccag
gatttccagcagttcgctaggacgccattgcagatgccggttctcgtcctgaccggacag
aaggccgccggtcgtttcacgatcgatcaggctcgcgtggcggcggtgaacgtgcagggg
gaagtgattgaaggggtgggccattggctgatgtccgaagcgcccgatcgaacgatgggg
gcgctggttacttttcttaatgcgggtgagtcgcgatga

DBGET integrated database retrieval system