KEGG   Burkholderia lata: Bcep18194_C6876Help
Entry
Bcep18194_C6876   CDS       T00286                                 

Definition
(GenBank) collagenase
  KO
K01387  microbial collagenase [EC:3.4.24.3]
Organism
bur  Burkholderia lata
Brite
KEGG Orthology (KO) [BR:bur00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bur01002]
    Bcep18194_C6876
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bur02042]
    Bcep18194_C6876
Enzymes [BR:bur01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.3  microbial collagenase
     Bcep18194_C6876
Peptidases [BR:bur01002]
 Metallo Peptidases
  Family M9
   Bcep18194_C6876
Bacterial toxins [BR:bur02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Bcep18194_C6876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M9 Peptidase_M9_N Peptidase_M61
Motif
Other DBs
NCBI-ProteinID: ABB05922
UniProt: Q39NP4
Position
3:425117..427093
Genome map
AA seq 658 aa AA seqDB search
MVVQKQPRENKVAINEGLQKTRRWSAIVAWSVFAGLAATASANTEPAQPTQPRQARMPRV
PQNLPVSPEQAQYNLPLSEQDRAALTRPSPLKQPATRSKRSTSGADCRDMSVMTQYRGAA
LADYIANLPDYECHYGLFSVDKVQATQIFNAENVHAAASRFVQEIHQYDASNLILVNLLI
YLRAAYYQYDVSGIANPIPNLAVSLRPYIKQSLEGDALYRDNARAPSTANELMKLITNMR
DEAFYLPTLKNRIASYTVSAANPQAAASLLQRSAAGGFTGLLTVFFYAHQRSGAQPMLDG
DATLPETLNRFVTANRASLSNTSAAYQLADAARETFRFLRYPTQKPRVKKMIQDMLASTS
MTGADSDLWLAAAEAVDYGDPGNCADYGTCDYKKRLTDAVLSNRYACNAGVRILAQDMTM
PQLQSVCTAVARQDDYFHRMMKTGRKPVAGDRNDTIELVIFDDYANYRKYASVIYGISTD
NGGMYLEGDPSAPGNQARFIAHEASWLRPEFKVWNLEHEFTHYLDGRYDMAGDFSVSTAK
PTVWWIEGVAEYLSRKNDNQESIDAVRTGAYRFSDVLGTRYASSDYVARAYRWGYMATRF
MFERHRADVDTIVSRFRAGDYDGYANHVAFIGNRYDTEFADWARNATTAGEPPVPAKR
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
ttggttgtccaaaaacaaccgagagaaaataaagtggcaataaacgaggggcttcaaaaa
acccgccgctggtcggccatcgtcgcgtggtcggtattcgccggactggccgccaccgca
tcagccaataccgagccggcgcagccgacgcaaccccggcaggcgcgcatgcctcgcgtg
ccgcagaatctgccggtgtcgcccgagcaggcgcagtacaacctgccgctcagcgagcag
gatcgcgcggcgctgaccaggccgtccccgctcaagcagccggccacgcgcagcaagcgc
agcacgtcgggcgccgattgccgcgacatgtcggtgatgacccagtatcgcggcgcggcg
ctcgccgattacatcgcgaatcttcccgattacgaatgccattacggcctgttctcggtc
gataaagtgcaggccacccagatcttcaatgccgaaaacgtgcacgctgctgcgagtcgt
ttcgtgcaggaaatccatcaatacgatgcgagcaatttgatcctggtcaatttgctgatt
tatctgcgtgccgcttattaccaatatgatgtatcgggcatcgcgaacccgatcccgaat
ctcgcggtgtcgctgcgcccgtatatcaagcaaagcctggagggcgatgcgctctatcgc
gacaatgcgcgcgcgccgagcaccgcgaacgagctgatgaagctcatcacgaacatgcgg
gacgaagcgttctacctgccgacgctgaagaaccgcatcgcgtcctacaccgtgagcgcg
gcgaatccgcaggcggcggcgtcgctgctgcagcgcagtgcggcgggcggcttcaccggc
ttgctcacggtgttcttctacgcgcaccagcgcagcggcgcgcagccgatgctcgacggc
gatgcgacgctcccggagacgctcaaccgcttcgtcaccgcgaaccgcgcgagcctgtcg
aacaccagcgccgcctatcagctggccgacgcggcgcgcgaaacgtttcgctttctccgc
tatccgacgcagaagccgcgcgtgaagaaaatgatccaggacatgctcgcgtcgacgagc
atgacgggcgcggacagcgatctctggctcgcggcggcggaagcggtcgactacggcgat
ccgggcaactgtgcggactacggcacctgcgactacaagaagcggctgaccgacgcggtg
ctctcgaatcgctacgcatgcaatgcgggcgtgcgcattctcgcgcaggacatgacgatg
ccgcagctgcagtcggtctgcacggcggtcgcgcggcaggacgactatttccaccggatg
atgaagaccgggcgcaagccggtcgcgggcgatcgcaacgacacgatcgaactcgtcatt
ttcgatgactacgcgaactaccgaaaatacgcgtcggtgatctacggcatcagcaccgac
aacggcggcatgtatctcgagggcgatccgtccgcgcccggcaaccaggcgcgcttcatc
gcgcacgaggcgtcgtggctgcggcccgagttcaaggtgtggaacctcgagcacgagttc
acgcactatctcgacggccgctacgacatggccggcgacttctcggtgagcaccgcgaag
ccgaccgtgtggtggatcgaaggcgtcgccgaatacctgtcgagaaagaacgacaaccag
gagtcgatcgacgcggtgcgcaccggcgcataccggttctcggacgtgctcggcacgcgt
tacgcgtcgagtgactacgtcgcgcgcgcgtaccggtggggctacatggcgacgcgtttc
atgttcgagcgccatcgcgcggacgtcgacacgatcgtgtcgcgcttccgggcgggcgat
tacgacggctacgcaaaccatgtcgcgttcatcggcaatcgctacgacaccgagttcgcc
gactgggcgcgcaacgcgacgacggcgggcgagccgccggtgccggcgaagcgctga

DBGET integrated database retrieval system