KEGG   Burkholderia lata: Bcep18194_C6882Help
Entry
Bcep18194_C6882   CDS       T00286                                 

Definition
(GenBank) NmrA-like protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 NmrA
Motif
Other DBs
NCBI-ProteinID: ABB05928
UniProt: Q39NN8
Position
3:435068..435898
Genome map
AA seq 276 aa AA seqDB search
MSALPTLIVGGSGKTGARVDARLRARGIATRPVSRTSAVRFDWTVPETWPAALEGVSAAY
VTYQPDLAVEGAVDAIAAFARLARESGVERVVLLSGRGEPRAQAAEAALQASGVGWGVVR
ASWFNQNFSEGYLIDGVLAGEVALPAGAVREPFVDADDIADVAVAALTDARFANRVIEVT
GPRALTFAEAVGEIARAAGRPVVYREIPADAFVAGLREVGVPEPVVALLDDLFSVVLDGR
NSAVTHGIEATLGRPARDFADYARATAATGVWSARS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcacttcccaccctcatcgtcggcggttcgggcaagacgggcgcccgcgtcgat
gcacggctgcgcgcgcgcggcatcgcaacccggcccgtgtcgcgcacgtcggccgtccgc
ttcgactggacggtgcccgagacgtggcccgccgcgcttgaaggcgtatcggccgcgtac
gtgacctaccagcccgacctggccgtcgaaggcgcggtggatgcgatcgccgcattcgcg
cggctcgcgcgggaaagcggcgtcgagcgcgtggtgctgctgtccggacgcggcgagccc
cgcgcgcaggccgccgaggccgcgttgcaggcgtcgggtgttggctggggcgtggtgcgc
gcgagctggttcaaccagaacttctccgagggctacctgatcgacggcgtgctggccggt
gaagtcgcgctgccggccggcgcggtgcgcgagccgttcgtcgatgcggacgacatcgcg
gacgtcgccgtggccgcgctcaccgatgcgcgcttcgcgaaccgcgtgatcgaggtcacg
ggcccgcgcgcgctgacgtttgccgaggcggtcggcgagatcgcacgggccgccggccgg
ccggtcgtctatcgcgagattccggccgatgcgttcgttgccggattgcgcgaggtcggc
gtgccggagccggtcgtcgcgctgctcgacgatctgttcagcgtggtgctcgacgggcgc
aacagcgcggtgacgcacggcatcgaagcgacactcgggcggccggcacgcgatttcgcc
gactatgcgcgcgcgacagccgcaaccggcgtgtggagcgcacgatcatga

DBGET integrated database retrieval system