KEGG   Burkholderia lata: Bcep18194_C6889Help
Entry
Bcep18194_C6889   CDS       T00286                                 

Definition
(GenBank) Major facilitator superfamily, (MFS_1) family
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4 BT1
Motif
Other DBs
NCBI-ProteinID: ABB05935
UniProt: Q39NN1
Position
3:complement(440493..441695)
Genome map
AA seq 400 aa AA seqDB search
MPPIASPAASPAAAPPAAASRGKIVAMAAIAGAVVTNIYCTQPILPLIAQDLQVAPATAD
LVAGAALLGFATGLALLLPLGDRYDRRKLVLGQIVLAFAFAVASALAPGVWALIGAAFSL
GVVSCVPQQLVPFAAVMSAPDERGRNVGTVVTGIMVGILLGRAVSGLIAAHAGWRAVYAV
EAAAMVPVGIAAAWLLPRGVPSTTLSYGRLLASLWTLARAHRPIRESMIVQALLWAAFNA
FWVNLAALLADGPWHLGSAWAGGFGLIGAAGALAATIGGRASDRIGTRRVIGLGIAIVTV
SYLILAGAGSSLALLVVGVVVLDIGVQAGLVANQTRAFAADPKAQGRINSLYMTATFVGG
AIGAIVSGALMARFGWHGVVAFGIAAGLAAALVHRCGARH
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccatcgcgtcacccgccgcgtcacccgccgcagcgccacccgccgccgcgtcg
cgcggcaagatcgtcgcgatggccgccatcgccggcgcggtcgtgaccaacatctattgc
acgcagccgatcctgccgttgatcgcacaggacctgcaggtcgccccggcgacggccgac
ctcgtggccggcgcggcgctgctcggcttcgcgaccgggctggcgctgctgctgccgctc
ggcgatcgctacgaccggcgcaagctggtgctgggccagatcgtgctggccttcgcgttc
gcggtggcgtccgcactcgcgccgggtgtatgggcgctgatcggtgccgcgttctcgctc
ggtgtggtcagctgcgtgccgcagcaactggtgccgttcgcggccgtgatgtccgcaccc
gatgaacgcgggcgcaacgtcggtacggtcgtcaccggcatcatggtcggcatcctgctg
ggccgcgcggtcagcggcctgatcgccgcgcacgccgggtggcgtgcggtgtatgccgtc
gaagccgccgcgatggtgccggtggggatcgccgccgcgtggttgctgccgcgcggcgtg
ccgagcaccacgctgtcgtatggccggctgctcgcgtcgctgtggacgctggcgcgcgca
catcgcccgatccgcgaatcgatgatcgtgcaggcgctgctgtgggccgcgttcaatgcg
ttctgggtcaatctcgccgcactgctcgccgacggcccgtggcatctcggcagcgcgtgg
gccggcggcttcggcctcattggcgcggcaggcgcactggccgccacgatcggcggccgg
gcgtcggaccggatcggcacgcggcgtgtgatcggcctgggcatcgcgatcgttacggtt
tcctatctgatcctcgccggcgccggcagctcgctcgcgctgctcgtggtcggcgtggtc
gtgctcgacatcggcgtgcaggccggcctggtcgcgaaccagacgcgcgcgttcgctgcc
gatccgaaggcacaggggcgcatcaacagcctctacatgaccgcgaccttcgtcggcggc
gcgattggcgcgatcgtcagcggtgcgctgatggcgcgcttcggctggcacggcgtggtc
gcgttcggcatcgcggcggggctcgcggccgcgctcgtgcatcgctgcggggcacggcac
tga

DBGET integrated database retrieval system