KEGG   Burkholderia lata: Bcep18194_C6890Help
Entry
Bcep18194_C6890   CDS       T00286                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_8 Tn916-Xis HTH_IclR Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: ABB05936
UniProt: Q39NN0
Position
3:441864..442775
Genome map
AA seq 303 aa AA seqDB search
MNRLESMSLLVAVIDAGSMSAAARQLGIPLATVSRKIADLESYLNTRLLHRTTRQLSLTE
AGESYVAGCRRILDDIAETERAATGEYAAPRGELIVTAPIVFGRLHIVPVLAAFLAHYPE
IDVRLVLTDRVTHLMEEQIDVALRIGELPDSSFMATRVGSVRRVICASPAYLAAHGTPTE
PTDLARHQCITFEVLASRRAWVFGGEKGELTVPVHSRFAVNTAEAAIDAAVLGVGLIRVL
SYQVAQALRDRTLDVVLDAFESQPLPVSLVHKGQAPMPLKLRAFLDFVAPRLRERIAGVG
AGD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcctggagtcgatgtccctgctggtggcggtgatcgacgccggcagcatgtcg
gccgccgcgcgccagctcggcattccgctggcgaccgtgagccgcaagatcgcggatctc
gagtcctacctgaatacgcgtctgctgcatcgcaccacgcggcaactgtcgctgaccgag
gcgggcgagtcgtacgtcgccggttgccggcgcatcctcgacgacatcgcggaaaccgag
cgtgccgccaccggcgaatatgcggcgccgcgcggcgagctgatcgtcaccgcgccgatc
gtgttcggacgcctgcatatcgtgccggtgctggctgcgttcctcgcccactatcccgag
atcgacgtgcggctggtgctgaccgaccgcgtcacgcacctgatggaagagcagatcgac
gtcgcactgcggatcggcgagttgcccgacagcagcttcatggcgacccgcgtcggcagc
gtgcgccgcgtgatctgcgcaagcccggcgtatctggcggcgcatggcacccccaccgaa
cccaccgacctcgcgcggcatcaatgcatcacgttcgaggtgctggcgtcgcggcgcgcg
tgggtgttcggcggcgagaagggcgagctgacggtgcccgtgcattcgcgcttcgcggtc
aatacggccgaggcggccatcgatgccgcagtgctcggtgtcgggttgatccgcgtgctg
tcgtatcaggttgcgcaggcgctgcgcgatcgcacgctcgacgtggtgctcgacgcgttc
gaatcgcagccgctgccggtcagcctggtgcacaaggggcaggcgccgatgccgctgaag
ctgcgcgcgtttctcgatttcgtggcgccgcggctgcgcgaacggatcgccggggtgggg
gcgggcgattga

DBGET integrated database retrieval system