KEGG   Burkholderia lata: Bcep18194_C6894Help
Entry
Bcep18194_C6894   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABB05940
UniProt: Q39NM6
Position
3:448067..448510
Genome map
AA seq 147 aa AA seqDB search
MESVAIGFFWTTSMPHLVVKRTVLVAMTIAYAACRADLPATRLTNKEATAALRAEIEMVA
EEQGRVALGTCKPALNPRYKDQVACTLLVISQAGTSETQADFHWDGQKWVSTPSESQDIL
PFPDPLLADIHSWTKNIDQLEPHFLKN
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgtcgcaatcggttttttctggacgacgtctatgccccatcttgtcgtgaag
cgcactgttcttgtggcgatgaccatcgcttacgcggcctgtcgtgccgatctgccggcg
acccggctcacgaacaaggaggcgacggcagcccttcgcgcagagatcgagatggtcgcg
gaggagcagggccgcgtcgcgctcggaacctgcaaaccggcgctgaatccacgctacaag
gatcaggtcgcctgtaccttgctggtgatcagtcaggcgggtacgtccgaaacacaggcc
gattttcattgggacgggcaaaaatgggtatccacgccgtcggagtctcaggacatcctg
ccctttcccgatccgctccttgcggacattcactcgtggacgaaaaacatcgaccagctg
gaaccgcattttctgaaaaactag

DBGET integrated database retrieval system