KEGG   Burkholderia lata: Bcep18194_C6900Help
Entry
Bcep18194_C6900   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABB05946
UniProt: Q39NM0
Position
3:complement(453900..454559)
Genome map
AA seq 219 aa AA seqDB search
MNVSTSNLNALPDIAGLMRLTQSLAILDAVLSPEWEYRYYSFNQAWADGEKMASMRNGSG
DQWFAIFSAAGAALHGVLRDAPMYRPGNPWPAIFSGLPEAFHANLLHEPAFTTHDSTFCI
WRLADETRWSCGPVESSTADDPDGSARLLGILAGRPEQYVEFAADYYECDIDPRDVAAVY
RHEPLAAGLVRRLNPECDFESLQDDLAEIGYPWSVSDDR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtctcgacaagcaatctgaacgcgctccccgacatcgccggcctgatgcgcctg
acacagtcgcttgcgatccttgatgctgtcttgtcgccggaatgggaataccgttactac
tcgttcaaccaggcctgggcagacggggagaagatggcgtcgatgcgcaacggctccggg
gaccagtggtttgcgatcttctccgccgcgggtgccgccctccacggcgtgctgcgcgac
gcgccgatgtaccggccgggcaacccctggcccgccatcttcagcggcctgcccgaagcc
tttcacgccaacctgctgcacgaaccggcatttaccacccatgacagcacgttctgcatc
tggcgccttgccgatgaaacgcgctggtcctgcgggccggtcgaatcgtccacggctgac
gacccggacggctccgcccgattgctcggcatactggccggacggcccgagcagtacgtc
gaattcgccgccgactattacgagtgcgacatcgatccgcgcgacgtcgcggccgtgtat
cgccacgaaccactcgccgccgggctcgtccggcggctcaatcccgaatgcgatttcgag
tccctgcaagacgatctcgccgagatcggttatccgtggtccgtctcggacgatcgctag

DBGET integrated database retrieval system