KEGG   Burkholderia lata: Bcep18194_C6901Help
Entry
Bcep18194_C6901   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3592
Motif
Other DBs
NCBI-ProteinID: ABB05947
UniProt: Q39NL9
Position
3:complement(454656..455180)
Genome map
AA seq 174 aa AA seqDB search
MRTLSVWLRSGILLAIGIAVVLWGGFTLADGVILRRAQAWPHVPATVEQCAATLQYGRHS
AYWEVSARFRYGDGREYVSAWQPADGLTDEHDPTPARTDAQTAAYCGAAAQDGLRVSPEF
PGIARLNSAAMSDEWEFKLMLGAALLLVGLVNGFTGFWLLRHGDPPPRRLFSRE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgctctccgtctggttgagatccgggatcctgctcgcgatcggcattgcggtc
gtgctgtggggcggcttcacgttggccgatggcgtgatcctgcggcgcgcgcaggcatgg
ccgcatgtgccggcgaccgtcgagcaatgcgcagcgacgctgcaatacggccggcattcc
gcgtactgggaagtcagcgcgcggttccgctacggagacgggcgtgaatatgtcagcgca
tggcagcccgccgatggtctgaccgacgagcacgatccaacgcctgcgcgcaccgacgcg
cagacggccgcttattgcggcgcggccgcgcaggacgggctgcgcgtgtcacccgagttt
cccggcatcgcgcgcctcaacagcgccgcgatgtcggacgaatgggaattcaagctgatg
ctgggcgcggcgctgctgctggtcggactggtcaacggctttaccggcttctggctgctg
cggcacggcgacccgccaccgcgccgcctgttttcgcgagagtag

DBGET integrated database retrieval system