KEGG   Burkholderia lata: Bcep18194_C6908Help
Entry
Bcep18194_C6908   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABB05954
UniProt: Q39NL2
Position
3:461904..462242
Genome map
AA seq 112 aa AA seqDB search
MHRTLVELERREYEKTHGHQSAGDFLQVMAFDDSMKWLEPLSRLIVMLDEALDQEGELEL
TPTVVVARTRELLKLDRASTDAFATRYLYHFDNSADLAVDHTALLKLIGNVA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
ttgcaccggaccctggtcgaacttgagcgtcgcgagtatgagaagacccatgggcaccaa
tcggccggcgattttctgcaggtgatggccttcgacgattcgatgaagtggctggagccg
ctcagccgactgatcgtcatgctggacgaagcgctggatcaagagggtgaactggagctg
acgccgacggtagtcgtggcgagaacacgggaattgctcaagctggaccgtgcgtccacg
gacgcatttgcgacgcgttatctgtatcacttcgacaactcggcggatctcgcggtcgac
cacactgcgttgttgaagctcatcggcaacgttgcgtag

DBGET integrated database retrieval system