KEGG   Burkholderia lata: Bcep18194_C6909Help
Entry
Bcep18194_C6909   CDS       T00286                                 

Definition
(GenBank) Peptidase M17, leucyl aminopeptidase-like protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M17_N
Motif
Other DBs
NCBI-ProteinID: ABB05955
UniProt: Q39NL1
Position
3:462482..463099
Genome map
AA seq 205 aa AA seqDB search
MVLRQIIGSWRDVSFEVAAWDGVGAQVDLSCGCMFAREAAGEGPTGGLRHLDLALSGALT
GLRREGHFLAAPMETLLISRPPAGIEVGRVLLIGLGDPASWTIDVTAAAAATAARTAMQQ
GLQSAAFAPSILDGGLTSAATDGMPHAMVTAVLATIDTQYRIAELGLSALPSLRHWVFDV
GASRFDGAVEQFGNALASAQSRRSK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggttctacggcagatcatcggcagttggcgtgatgtgtccttcgaagttgccgcatgg
gatggcgtcggcgcgcaggtcgatctttcctgcggttgcatgttcgcccgcgaggcggca
ggtgaggggccgacgggcggactacgccatctcgacctcgcgctttcgggggcgctcacc
gggttgcggcgcgaaggccactttctggcggcgccgatggaaacactgttgatcagccgc
ccgcccgcgggtatcgaagtgggccgcgtgctgttgatcgggctcggtgatcccgcaagc
tggaccattgatgtcaccgcggctgccgccgccacggccgcgcgaacggcgatgcagcag
ggtttgcaaagtgcagccttcgcgccgagcatactcgacggcgggttgacgagtgcggct
accgacggtatgccgcacgccatggtgacggccgtgctggccacgatagacacacaatac
cggatcgcggaactggggctctctgcgctaccgtcactgcgccattgggtcttcgatgtc
ggcgcgtcccgctttgacggagcggtagaacaattcggaaacgcactggcgagtgcacag
tcccggcgctcgaagtag

DBGET integrated database retrieval system