KEGG   Burkholderia lata: Bcep18194_C6910Help
Entry
Bcep18194_C6910   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mrr_cat HSDR_N_2
Motif
Other DBs
NCBI-ProteinID: ABB05956
UniProt: Q39NL0
Position
3:complement(463357..464193)
Genome map
AA seq 278 aa AA seqDB search
MIDDPLPKNWQDLQTGVQRIFRNVGLRADVEVDLETPRGSVNVDVLAVDVRSVDKIRYIV
ECKNWSSAVPQSVVHSFTTIMQETGANIGLVISKQGLQQGAKRYTQNTNIVGMTYLEFQQ
RYFEAWWKRYFCPRIGDAADKPLQYIEEFNIDRDDAYKKLSRQGQDKFDRLRRENSGPVM
FMSMFNYMALSPMLGTGTMLDVPTNLSEFKNNVLAKITPHIEWHCDTFRGLLGIMLQYLA
DVEADFDAVFGGSIFEPREPISGVTADGPPLDDGIYHR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgattgatgaccctttaccaaaaaattggcaagaccttcaaacaggcgttcaacgtatc
ttccgtaacgtcgggttacgtgctgatgtcgaggtcgatttggaaacaccgcgtggctcg
gtgaatgttgatgtcctcgcagtagacgttcggagtgtcgacaaaattaggtacatcgtc
gaatgcaaaaattggagtagcgcagtaccccaatccgtcgttcactccttcacaacgata
atgcaagaaactggtgcaaatataggattagtcatttctaagcaggggcttcaacaaggt
gctaagcgatacacccagaacacgaatatagtggggatgacgtaccttgagtttcagcaa
agatattttgaggcgtggtggaaaaggtacttctgcccacgtatcggtgacgccgcagac
aaaccgctccaatacatcgaagaattcaatattgatcgagacgacgcatacaagaagctt
agccgtcaaggtcaggataagtttgatcggttgcggcgagagaacagtgggccggtaatg
ttcatgtccatgtttaattacatggctttgtctccgatgttgggcacgggcaccatgtta
gacgttccaacgaatctaagtgaatttaagaataacgtcttagcaaagattacgccccac
atcgaatggcactgtgatacgtttcgaggattgctcggcattatgttgcagtacctagca
gacgtggaagcagacttcgacgcagtgtttggtggatccatttttgagccacgagagcct
atcagcggagtgactgctgatggcccccctttggatgatggcatttatcatcggtga

DBGET integrated database retrieval system