KEGG   Burkholderia lata: Bcep18194_C6914Help
Entry
Bcep18194_C6914   CDS       T00286                                 

Definition
(GenBank) Endoribonuclease L-PSP
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_L-PSP
Motif
Other DBs
NCBI-ProteinID: ABB05960
UniProt: Q39NK6
Position
3:468655..469053
Genome map
AA seq 132 aa AA seqDB search
MYLNLTGGIFKMRKRISTGSPWEPKVGYSRAVVVDNTIYISGTAGKGADVYAQTRDALAT
IDRVLADSGFALSDVVQSRLVVADFDNWEAAARAHGEIYGDIRPAFSLVHALPFVDPEIL
VEVEAIAVRAAA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtatctcaacctgactggagggatcttcaagatgcgtaaacggatcagcaccggctcc
ccgtgggagcccaaggtcggctactcgcgcgcggtggtcgtcgacaacaccatctacatt
tcggggacggcgggcaaaggcgcggacgtgtacgcgcagacacgcgatgcgctggcgacg
atcgaccgtgtgctggcggacagcgggttcgcgttgtcggatgttgtccagagccgcctg
gtggtggcggacttcgacaactgggaagcggcggcgcgcgcgcacggggaaatctacggc
gatatccggccggcgttttcgctggtgcacgcgcttccgttcgtcgatccggaaatcctg
gtcgaagtcgaggcgatcgcggtcagggccgcggcatga

DBGET integrated database retrieval system